Share this post on:

Name:
IL-9 Protein

Synonyms:

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P15248

Gene Id:
Gln19-Ile144QGCPTLAGILDINFLINKMQEDPASKCHCSANVTSCLCLGIPSDNCTRPCFSERLSQMTNTTMQTRYPLIFSRVKKSVEVLKNNKCPYFSCEQPCNQTTAGNALTFLKSLLEIFQKEKMRGMRGKI

Molecular Weight:
15kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris,200mM NaCl, pH8.0

Quality Statement:
Nterleukin-9 (IL-9) was originally identified in mice as a T cell growth factor and is a member of the common γ-chain-receptor cytokine family, with other members including IL-2, IL-4, IL-7, IL-15 and IL-21. The IL-9 gene loci of both humans and mice have a similar organization, consisting of five exons, and share a 55% amino acid homology at the protein level. The IL-9 receptor consists of the cytokine-specific IL 9 receptor α-chain (IL-9Rα) and the γ-chain1. IL-9 induced receptor activation promotes the cross phosphorylation of Janus kinase 1 (JAK1) and JAK3. This cross-phosphorylation leads to the downstream activation of signal transducer and activator of transcription (STAT) complexes, specifically STAT1 homodimers, STAT5 homodimers and STAT1–STAT3 heterodimers. Although the contribution of IL-9 to the activation of these pathways in primary cells has not been fully elucidated, it may be of relevance in vivo.

Reference:
1.\tRandolph J Noelle and Elizabeth C Nowak (2010) Nat Rev Immunol. 10(10):683-7.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SULT1A3 ProteinStorage & Stability
ROR1 ProteinStorage & Stability
Popular categories:
CD284/TLR4
CD28

Share this post on:

Author: Adenosylmethionine- apoptosisinducer