Share this post on:

Name:
G-CSF Protein

Synonyms:
Granulocyte colony-stimulating factor

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P09920

Gene Id:
Val31-Ala208 VPLVTVSALPPSLPLPRSFLLKSLEQVRKIQASGSVLLEQLCATYKLCHPEELVLLGHSLGIPKASLSGCSSQALQQTQCLSQLHSGLCLYQGLLQALSGISPALAPTLDLLQLDVANFATTIWQQMENLGVAPTVQPTQSAMPAFTSAFQRRAGGVLAISYLQGFLETARLALHHLA

Molecular Weight:
19kDa

Purity:
>95% by SDS-PAGE&RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20 mM PB, 150mM NaCl, 5%海藻糖,pH 6.5

Quality Statement:
As key factors in hematopoietic development, G-CSF/GM-CSF are well-known facilitators of myelopoiesis and mobilization of hematopoietic stem cells (HSCs). In addition, these two cytokines can also promote or inhibit tumors, dependent on tumor type. In multiple cancer types, hematopoiesis is greatly enhanced and abnormal lineage differentiation is induced by these two cytokines. Numerous preclinical studies have reported a pro-tumour role for granulocyte colony-stimulating factor (G-CSF) that is predominantly mediated by neutrophils and MDSCs, the major G-CSF receptor expressing populations. Granulocyte-Macrophage colony stimulating factor (GM-CSF) and Granulocyte colony stimulating factor (G-CSF) are cytokines involved in the differentiation of bone marrow progenitor cells into myeloid cells. They also activate mature myeloid cells to mediate a variety of antimicrobial activities and inflammatory responses. Recombinant GM-CSF and G-CSF proteins have been used to treat various diseases including cancer and hematopoietic diseases and to isolate peripheral blood progenitor cells for bone marrow transplantation.

Reference:
1.FEBS Open Bio. 2022 Jul;12(7):1268-1285. doi: 10.1002/2211-5463.13445. Epub 2022 Jun 9. 2.Eur Cytokine Netw. 2004 Jul-Sep;15(3):255-62. 3.Semin Immunol. 2021 Apr:54:101512. doi: 10.1016/j.smim.2021.101512. 4.Epub 2021 Nov 8.Biotechnol Lett. 2003 Feb;25(3):205-11. doi: 10.1023/a:1022346800375.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-6 Proteinmanufacturer
Amphiregulin Proteinsupplier
Popular categories:
Complement Receptor 4
ADAMTS17

Share this post on:

Author: Adenosylmethionine- apoptosisinducer