Name:
TNF-α Protein
Synonyms:
TNF-α, TNF-alpha, Tumor necrosis factor ligand superfamily member 2, TNF-a, Cachectin, DIF, TNFA, TNFSF2
Species Name:
Rat
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P16599
Gene Id:
Leu80-Leu235LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
Molecular Weight:
17kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 300mM NaCl, pH8.0
Quality Statement:
Tumor Necrosis Factor alpha (TNF-α), is an inflammatory cytokine produced by macrophages/monocytes during acute inflammation and is responsible for a diverse range of signaling events within cells, leading to necrosis or apoptosis. TNF alpha exerts many of its effects by binding to either a 55 kDa cell membrane receptor termed. TNFα activates signals through two receptors, TNF-R1, which is expressed on most cell types, and TNF-R2, which is expressed mainly on immune cells. TNFα can have many functions including, to stimulate of phagocytosis in macrophages, to chemoattract neutrophils, to increase insulin resistance and to induce fever.
Reference:
1.Hector J. et al. (2007) TNF-alpha alters visfatin and adiponectin levels in human fat. Horm Metab Res. 39(4): 250-255. 2.Berthold-Losleben M. et al. (2008) The TNF-alpha System: Functional Aspects in Depression, Narcolepsy and Psychopharmacology. Curr Neuropharmacol. 6(3): 193-202.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Serpin E1 ProteinBiological Activity
Ephrin-B2/EFNB2 ProteinFormulation
Popular categories:
Serine Carboxypeptidase 1
CD122/IL-2R beta
