Name:
SerpinB3/SCCA Protein
Synonyms:
SerpinB3, SCCA1;Serpin B3, Protein T4-A, Squamous cell carcinoma antigen 1, SCCA-1,serine (or cysteine) proteinase inhibitor, clade B (ovalbumin), member 3, serpin peptidase inhibitor, clade B (ovalbumin), member 3, Squamous cell carcinoma antigen 1, T4-A,SCCA1
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P29508
Gene Id:
MHHHHHHDDDDKNSLSEANTKFMFDLFQQFRKSKENNIFYSPISITSALGMVLLGAKDNTAQQIKKVLHFDQVTENTTGKAATYHVDRSGNVHHQFQKLLTEFNKSTDAYELKIANKLFGEKTYLFLQEYLDAIKKFYQTSVESVDFANAPEESRKKINSWVESQTNEKIKNLIPEGNIGSNTTLVLVNAIYFKGQWEKKFNKEDTKEEKFWPNKNTYKSIQMMRQYTSFHFASLEDVQAKVLEIPYKGKDLSMIVLLPNEIDGLQKLEEKLTAEKLMEWTSLQNMRETRVDLHLPRFKVEESYDLKDTLRTMGMVDIFNGDADLSGMTGSRGLVLSGVLHKAFVEVTEEGAEAAAATAVVGFGSSPTSTNEEFHCNHPFLFFIRQNKTNSILFYGRFSSP
Molecular Weight:
45.9 kDa
Purity:
＞90%, by SDS-PAGE under reducing conditions
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<2EU/μg
Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .
Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris-HCl, 150mM NaCl, pH8.0
Quality Statement:
SerpinB3/SCCA belongs to tumor-related glycoprotein antigen, also known as TA-4 antigen, which widely exists in the cytoplasm of uterine, cervical, lung and other squamous cell carcinoma, and has a high content in non-keratinized cancer cells, which is closely related to the occurrence and development of squamous cell carcinoma. In normal squamous epithelial cells, SerpinB3/SCCA inhibits apoptosis and participates in the differentiation of squamous epithelium, but participates in the physiological processes such as invasion, metastasis and recurrence of cancer cells in tumor cells. As a specific marker of squamous cell carcinoma, the concentration of SerpinB3/SCCA increases with the aggravation of the disease, and it is an important tumor marker reflecting the biological characteristics of squamous cell carcinoma. Its serum level is widely used in the diagnosis of squamous cell carcinoma of many organs and clinical evaluation of therapeutic effect.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Insulin-1/Ins1 ProteinStorage & Stability
HSP70/HSPA1A Proteincustom synthesis
Popular categories:
Angiotensin-Converting Enzyme 2 (ACE2)
HPV E7 Proteins
