Name:
IL-36β Protein
Synonyms:
\nIl36β;Interleukin-36 beta; Interleukin-1 family member 8; IL-1F8; Fil1e; Il1f8;
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
Q9NZH7-2
Gene Id:
Met1-Glu157MNPQREAAPKSYAIRDSRQMVWVLSGNSLIAAPLSRSIKPVTLHLIACRDTEFSDKEKGNMVYLGIKGKDLCLFCAEIQGKPTLQLKEKNIMDLYVEKKAQKPFLFFHNKEGSTSVFQSVSYPGWFIATSTTSGQPIFLTKERGITNNTNFYLDSVE
Molecular Weight:
18kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris,50mM NaCl,pH8.0.
Quality Statement:
Interleukin-36 is a pro-inflammatory cytokine which plays an important role in the pathophysiology of several diseases. IL-36α, IL-36β, and IL-36γ (formerly IL-1F6, IL-1F8, and IL-1F9) are IL-1 family members that signal through the IL-1 receptor family members IL-1Rrp2 (IL-1RL2) and IL-1RAcP. IL-36βactivates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. IL-36βare involved in a number of fundamental biological processes such as stimulating production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes, inducing expression of a number of antimicrobial peptides including beta-defensin 4 and beta-defensin 103 as well as a number of matrix metalloproteases , inducing the production of proinflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, IL-1 beta, IL-6, TNF-alpha and IL-23, and activating p38 MAPK phosphorylation in BMDCs.
Reference:
1.Arthritis Res Ther. 2006;8(3):R80. doi: 10.1186/ar1946. 2.Epub 2006 Apr 28.Obesity (Silver Spring). 2010 Nov;18(11):2234-6. doi: 10.1038/oby.2010.55. 3.Epub 2010 Mar 18.J Immunol. 2011 Feb 15;186(4):2613-22. doi: 10.4049/jimmunol.1003162. 4.J Invest Dermatol. 2011 Dec;131(12):2428-37. doi: 10.1038/jid.2011.234. Epub 2011 Sep 1.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD58 Proteinmanufacturer
Lymphocyte antigen 86/MD-1 Proteinweb
Popular categories:
Integrin beta 2/CD18
CD49f/Integrin alpha-6
