Share this post on:

Name:
Fc γ RIIa/CD32a Protein

Synonyms:
Fc γ RIIa, CD32a(R167) ;Low affinity immunoglobulin gamma Fc region receptor II-a, IgG Fc receptor II-a, CDw32, Fc-gamma RII-a, Fc-gamma-RIIa, FcRII-a, CD32, FCGR2A, FCG2, FCGR2A1, IGFR2

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P12318-1

Gene Id:
AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIHHHHHHHHHH

Molecular Weight:
25-33 kDa(Reducing)

Purity:
>95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS pH7.2, 5% trehalose

Quality Statement:
IgG Fc receptor (Fc gamma R) is a member of the Ig superfamily and plays a role in activating or suppressing immune responses. Human Fc gamma Rs can be divided into three types: RI (CD64), RII (CD32) and RIII (CD16), which can produce a variety of subtypes (1-3). Fc gamma RI is a high affinity receptor for binding monomer IgG, while Fc gamma RII and RIII are low affinity receptors for binding aggregation or immune complex IgG (IC). The extracellular domain of human Fc gamma RIIA has about 90% amino acid sequence homology with human Fc gamma RIIB and Fc gamma RIIC. Fc gamma RIIA is expressed in many immune cell types (macrophages, neutrophils, eosinophils, platelets, dendritic cells and Langerhans cells). Inhibition of ITIM receptors may also be co-expressed and co-participated through specific ligands. Inflammatory responses (cytolysis, phagocytosis, degranulation and production of cytokines) are initiated by Fc γ RIIA signals, which can be regulated by inhibitory receptor signals. The intensity of the signal depends on the expression ratio of the activated receptor and the inhibitory receptor. The two alleles of Fc gamma RIIA (R167 and H167) are different in the ability to connect human IgG2 or CRP.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PDGF R alpha ProteinMedChemExpress
SPARCL1 Proteinmanufacturer
Popular categories:
BTLA/CD272
CD302/CLEC13A

Share this post on:

Author: Adenosylmethionine- apoptosisinducer