Name:
Biotinylated C1qR1/CD93 Protein
Synonyms:
C1q/MBL/SPA receptor, C1qR, C1qRp, C1qR(p), CD93, Complement component 1 q subcomponent receptor 1, Matrix-remodeling-associated protein 4
Species Name:
Human
Label Name:
Avi Tag, His Tag
Marker Name:
Biotin
Accession:
Q9NPY3
Gene Id:
Thr22-Lys580TGADTEAVVCVGTACYTAHSGKLSAAEAQNHCNQNGGNLATVKSKEEAQHVQRVLAQLLRREAALTARMSKFWIGLQREKGKCLDPSLPLKGFSWVGGGEDTPYSNWHKELRNSCISKRCVSLLLDLSQPLLPSRLPKWSEGPCGSPGSPGSNIEGFVCKFSFKGMCRPLALGGPGQVTYTTPFQTTSSSLEAVPFASAANVACGEGDKDETQSHYFLCKEKAPDVFDWGSSGPLCVSPKYGCNFNNGGCHQDCFEGGDGSFLCGCRPGFRLLDDLVTCASRNPCSSSPCRGGATCVLGPHGKNYTCRCPQGYQLDSSQLDCVDVDECQDSPCAQECVNTPGGFRCECWVGYEPGGPGEGACQDVDECALGRSPCAQGCTNTDGSFHCSCEEGYVLAGEDGTQCQDVDECVGPGGPLCDSLCFNTQGSFHCGCLPGWVLAPNGVSCTMGPVSLGPPSGPPDEEDKGEKEGSTVPRAATASPTRGPEGTPKATPTTSRPSLSSDAPITSAPLKMLAPSGSPGVWREPSIHHATAASGPQEPAGGDSSVATQNNDGTDGQKGGGSGGGSHHHHHHHHHHGLNDIFEAQKIEWHE
Molecular Weight:
90-95kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
Complement component 1q (C1q) receptor 1 (C1qR1, also known as C1qRp, or cluster of differentiation 93-CD93) is a 126-kDa type 1 transmembrane glycoprotein expressed in endothelial and hematopoietic cells, and responsible for C1q-induced phagocytosis. CD93 contains one C-type lectin domain and five EGF-like domains. Mature human CD93 consists of a 557 amino acid (aa) extracellular domain (ECD) with one C‑type lectin domain, four tandem EGF‑like domains, and a mucin‑like domain, followed by a 21 aa transmembrane segment and a 51 aa cytoplasmic domain. CD93 is receptor for C1q, mannose-binding lectin (MBL2) and pulmonary surfactant protein A (SPA). Soluble CD93 promotes the differentiation of monocytes to macrophages, phagocytosis of apoptotic cells, and inflammatory responsiveness to multiple TLR ligands.
Reference:
1. Greenlee-Wacker M.C., Briseño C., Galvan M., Moriel G., Velázquez P., Bohlson S.S. Membrane-Associated CD93 Regulates Leukocyte Migration and C1q-Hemolytic Activity during Murine Peritonitis. J. Immunol. 2011;187:3353–3361.2. Nepomuceno R.R., Henschen-Edman A.H., Burgess W.H., Tenner A.J. cDNA cloning and primary structure analysis of C1qRp, the human C1q/MBL/SPA receptor that mediates enhanced phagocytosis in vitro. Immunity. 1997;6:119–129. 3. Nepomuceno R.R., Tenner A.J. C1qRp, the C1q receptor that enhances phagocytosis, is detected specifically in human cells of myeloid lineage, endothelial cells, and platelets. J. Immunol. 1998;160:1929–1935.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TRAIL R1/TNFRSF10A ProteinBiological Activity
GMF-beta Proteincustom synthesis
Popular categories:
Protein Kinase Inhibitor Peptide (PKI)
Signal Regulatory Protein gamma
