Share this post on:

Name:
NAP-2/CXCL7 Protein

Synonyms:
PPBP, B-TG1, Beta-TG, CTAP-III, CTAP3, CTAPIII, CXCL-7, LA-PF4, LDGF, MDGF, NAP2, PBP, SCYB7, TC1, TC2, TGB, TGB1, THBGB, THBGB1, pro-platelet basic protein

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P02775

Gene Id:
Ala59-Asp128 AELRCMCIKTTSGIHPKNIQSLEVIGKGTHCNQVEVIATLKDGRKICLDPDAPRIKKIVQKKLAGDESAD

Molecular Weight:
9kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to-70 °C as supplied. ·1 month, 2 to 8 °C under sterileconditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 300mM NaCl, pH8.0

Quality Statement:
Neutrophil Activating Peptide 2 (NAP-2), also known as CXCL7, is a platelet-derived growth factor that belongs to the CXC chemokine family. This growth factor is a potent chemoattractant and activator of neutrophils. Recently, it has been shown that CXCL7 is secreted by tumor infiltrating monocytes, to stimulate cancer cell migration, invasion, and metastasis, contributing to the promotion of breast cancer progression. It also stimulates the formation and secretion of plasminogen activator by synovial cells. The protein also is an antimicrobial protein with bactericidal and antifungal activity.

Reference:
Wang YH, Shen CY, Lin SC, Kuo WH, Kuo YT, HsuYL, Wang WC, Lin KT, Wang LH. Monocytes secrete CXCL7 to promote breast cancerprogression. Cell Death Dis. 2021 Nov 17;12(12):1090. doi:10.1038/s41419-021-04231-4. PMID: 34789744; PMCID: PMC8599470.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-10 Proteinsite
TSLP Proteinweb
Popular categories:
Insulin-like Growth Factor 1 Receptor (IGF-I R)
Cathepsin

Share this post on:

Author: Adenosylmethionine- apoptosisinducer