Name:
PF-4/CXCL4 Protein
Synonyms:
Platelet Factor 4, PF-4, C-X-C Motif Chemokine 4, Iroplact, Oncostatin-A
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
P02776
Gene Id:
Glu32-Ser101HHHHHHMEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Molecular Weight:
11-14KDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 600mM NaCl, pH8.0
Quality Statement:
PF-4/CXCL4 is a member of the CXC chemokine family produced by cells of the megakaryocytic lineage. In megakaryocytes CXCL4 is synthesized, enclosed in vesicles, and transferred to the granules from which it is secreted following platelet activation.1 More recently, CXCL4 expression was also found in monocytes. The first biological function described for CXCL4 is its antiheparin activity, responsible for the important role of CXCL4 in the regulation of coagulation processes.Chemokines regulate leukocyte migration during physiological and pathological conditions. It is currently accepted that these chemotactic cytokines are also important in the development and progression of cancer. CXCL4 and its non-allelic variant CXCL4L1 are two platelet-associated chemokines that have been attributed anti-tumoral activity as a result of their angiostatic potential and the chemotactic activity for anti-tumoral leukocytes.
Reference:
1.\tLaura Lasagni, et al. (2007) Blood. 109(10):4127-34. 2.\tPieter Ruytinx. et al. (2018) Cytokine. 109:65-71.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
UGT1A1Purity & Documentation
IL-7 ProteinBiological Activity
Popular categories:
Glucocorticoid Receptor
CXCL9
