PDGF-AA Protein | Adenosylmethionine

Name:
PDGF-AA Protein

Synonyms:
Platelet-Derived Growth Factor-AA, Glioma-derived growth factor, GDGF, Osteosarcoma-derived Growth Factor, ODGF

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P20033-1

Gene Id:
Ser87-Thr211 MSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATSNLNPDHREEETGRRRESGKNRKRKRLKPT

Molecular Weight:
29kDa

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4

Quality Statement:
Platelet-derived growth factor (PDGF) is a family of three disulfide-linked glycoprotein dimers of M.W. 29kDa-32kDa that arise from astochastic assembly of the homologous subunits, A-chain and B-chain, yielding the heterodimer PDGF-AB and homodimers PDGF-AA and PDGF-BB. PDGF-AA and its receptor represent an important epithelial-mesenchymal interaction which plays a critical role in early lung branching morphogenesis.

Reference:
1.\tSouza P, Kuliszewski M, Wang J, Tseu I, Tanswell AK, Post M. PDGF-AA and its receptor influence early lung branching via an epithelial-mesenchymal interaction. Development. 1995 Aug;121(8):2559-67. doi: 10.1242/dev.121.8.2559. PMID: 7671819. 2.\tDemaria M, Ohtani N, Youssef SA, Rodier F, Toussaint W, Mitchell JR, Laberge RM, Vijg J, Van Steeg H, Dollé ME, Hoeijmakers JH, de Bruin A, Hara E, Campisi J. An essential role for senescent cells in optimal wound healing through secretion of PDGF-AA. Dev Cell. 2014 Dec 22;31(6):722-33. doi: 10.1016/j.devcel.2014.11.012. Epub 2014 Dec 11. PMID: 25499914; PMCID: PMC4349629.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GRP-78 Proteinweb
CXCL7 Proteinweb
Popular categories:
SRSF Protein Kinase 3
ADAM1/Fertilin alpha

Author: Adenosylmethionine- apoptosisinducer

Related Posts