Name:
MDC/CCL22 Protein
Synonyms:
C-C motif chemokine 22, CC chemokine STCP-1, Macrophage-derived chemokine, Small-inducible cytokine A22, Stimulated T-cell chemotactic protein 1
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
O00626
Gene Id:
Gly25-Gln93GPYGANMEDSVCCRDYVRYRLPLRVVKHFYWTSDSCPRPGVVLLTFRDKEICADPRVPWVKMILNKLSQ
Molecular Weight:
9kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM Tris, 0.7M NaCl, pH 8.0
Quality Statement:
CCL22 is a macrophage-derived immunosuppressive chemokine that recruits regulatory T cells through the CCL22:CCR4 axis. It was shown to play a key role in suppressing anti-cancer immune responses in different cancer types. The chemokine CCL22, predominately produced by dendritic cells (DCs), regulates T reg migration via binding to its receptor CCR4. CCL22 controls T cell immunity, both by recruiting T regs to the tumor tissue and by promoting the formation of DC-T reg contacts in the lymph node. There was article showed that tumor-associated macrophages (TAMs) produced an abundance of C-C motif chemokine 22 (CCL22), whose expression in the tumor stroma was positively associated with the level of intratumoral phospho-focal adhesion kinase (pFAK Tyr397), tumor metastasis and reduced patient survival.
Reference:
1. Cell Mol Immunol. 2022 Sep;19(9):1054-1066. doi: 10.1038/s41423-022-00903-z. Epub 2022 Aug 12. 2. Adv Exp Med Biol. 2020:1231:79-96. doi: 10.1007/978-3-030-36667-4_8. 3.Oncoimmunology. 2022 Aug 29;11(1):2115655. doi: 10.1080/2162402X.2022.2115655. eCollection 2022.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
PCSK9 ProteinStorage & Stability
CD99 ProteinSource
Popular categories:
ALK-4/Activin RIB
CD59
