Name:
RANTES/CCL5 Protein
Synonyms:
CCL-5, D17S136E, RANTES, SCYA5, SIS-delta, SISd, TCP228, eoCP, C-C motif chemokine ligand 5
Species Name:
Human
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P13501
Gene Id:
Ser24-Ser91 SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Molecular Weight:
8kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to-70 °C as supplied. ·1 month, 2 to 8 °C under sterileconditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
50mM Gly, 500mM NaCl, pH10.0
Quality Statement:
Chemokines form a superfamily of secretedproteins involved in immunoregulatory and inflammatory processes. CC motifchemokine ligand 5 (CCL5), a member of the CC subfamily, functions as achemoattractant for blood monocytes, memory T helper cells and eosinophils. Itfunctions as one of the natural ligands for the chemokine receptor chemokine(C-C motif) receptor 5 (CCR5), and it suppresses in vitro replication of the R5strains of HIV-1, which use CCR5 as a coreceptor.Researchesdemonstrate that chordoma accelerated tumor progression through autocrine CCL5acting on tumor cells and paracrine CCL5 polarizing macrophages into M2 TAMs tofacilitate immune escape. Targeting M2 macrophages and the CCL5–CCR5 axis istherefore expected to improve the prognosis of patients with chordoma.
Reference:
1.XuJ, Shi Q, Lou J, Wang B, Wang W, Niu J, Guo L, Chen C, Yu Y, Huang Y, Guo W,Lan J, Zhu Y, Ren T, Tang X. Chordoma recruits and polarizes tumor-associatedmacrophages via secreting CCL5 to promote malignant progression. J ImmunotherCancer. 2023 Apr;11(4):e006808. doi: 10.1136/jitc-2023-006808. PMID: 37185233;PMCID: PMC10151997. 2.Dunbar KJ, Karakasheva TA, Tang Q, Efe G, Lin EW,Harris M, Sahu V, Sachdeva UM, Hu J, Klein-Szanto AJ, Henick B, Diehl JA,Nakagawa H, Rustgi AK. Tumor-Derived CCL5 Recruits Cancer-AssociatedFibroblasts and Promotes Tumor Cell Proliferation in Esophageal Squamous CellCarcinoma. Mol Cancer Res. 2023 Jul 5;21(7):741-752. doi:10.1158/1541-7786.MCR-22-0872. PMID: 37027010; PMCID: PMC10330279.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
MMP-9 ProteinPurity & Documentation
GRO-beta/CXCL2 ProteinMedChemExpress
Popular categories:
MMP-20
Carbonic Anhydrase 7 (CA-VII)
