Share this post on:

Name:
MARCO Protein

Synonyms:
MARCO, SCARA2, Macrophage receptor with collagenous structure, Scavenger receptor class A member 2

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q9UEW3

Gene Id:
Ser405-Val520HHHHHHHHGGGSSGEQGVKGEKGERGENSVSVRIVGSSNRGRAEVYYSGTWGTICDDEWQNSDAIVFCRMLGYSKGRALYKVGAGTGQIWLDNVQCRGTESTLWSCTKNSWGHHDCSHEEDAGVECSV

Molecular Weight:
14-17kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
50mM Tris,0.1M NaCl,0.3M Arg, pH8.0.

Quality Statement:
MARCO (macrophage receptor with collagenous structure), also known as SCARA2, is an 80 kDa type II transmembrane glycoprotein that belongs to the class A scavenger receptor family. MARCO is constitutively expressed on the surface of splenic and lymph node macrophages. Its expression is induced on Kupffer cells and alveolar macrophages by microbial infection, chemical irritants, and Th1 polarizing factors. MARCO binds LPS, lipoteichoic acid, and other determinants on Gram positive and negative bacteria. It also binds modified LDL, CpG oligonucleotides, UGRP1, silica, and TiO2. MARCO is required for the organization of the splenic marginal zone and the interaction of local macrophages and B cells.

Reference:
1.Sheetal, A. et al. (2008) J. Immunotoxicol. 5:151.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ECM1 ProteinSynonyms
ADK/Adenosine Kinase ProteinSource
Popular categories:
CCR7
Endothelial Cell-Selective Adhesion Molecule (ESAM)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer