Share this post on:

Name:
CTLA-4/CD152 Protein

Synonyms:
Celiac Disease 3,Ligand And Transmembrane Spliced Cytotoxic T Lymphocyte Associated Antigen 4,Cytotoxic T-Lymphocyte Protein 4,CD152,Cytotoxic T-lymphocyte-associated antigen 4,CTLA4,CTLA-4,Cytotoxic T-Lymphocyte Associated Protein 4,Insulin-Dependent Diabetes Mellitus 12,Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form,Cytotoxic T-Lymphocyte-Associated Serine Esterase-4,CD152 Isoform,CD152 Antigen,CELIAC3,IDDM12,ALPS5,GRD4,GSE,CD,CTLA-4 Antigen

Species Name:
Cynomolgus

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
XP_005574071.1

Gene Id:
Ala37-Asp161AMHVAQPAVVLANSRGIASFVCEYASPGKATEVRVTVLRQADSQVTEVCAATYMMGNELTFLDDSICTGTSSGNQVNLTIQGLRAMDTGLYICKVELMYPPPYYMGIGNGTQIYVIDPEPCPDSDGGGSHHHHHHHH

Molecular Weight:
17-25kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.

Reference:
1.Shuang Qin, Linping Xu, Ming Yi, Shengnan Yu,Kongming Wu & Suxia Luo: Novel immune checkpoint targets: moving beyondPD-1 and CTLA-4: MolecularCancer volume 18, Article number: 155 (2019).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Thioredoxin/TXN ProteinPurity & Documentation
HAAO ProteinPurity & Documentation
Popular categories:
Cystatin-1
Cystatin Family

Share this post on:

Author: Adenosylmethionine- apoptosisinducer