Share this post on:

Name:
CTLA-4/CD152 Protein

Synonyms:
CTLA4, CD152

Species Name:
Rat

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q62859

Gene Id:
Ile38-Asp161 IQVTQPSVVLASSHGVASFPCEYASSHNTDEVRVTVLRQTNDQVTEVCATTFTVKNTLGFLDDPFCSGTFNESRVNLTIQGLRAADTGLYFCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSDGGGSHHHHHHHH

Molecular Weight:
19-26kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Cytotoxic T-lymphocyte protein 4, also known as CTLA4 and CD152, is a single-pass type I membrane protein. CTLA4 is a member of the immunoglobulin superfamily, which is expressed on the surface of Helper T cells and it is also found in regulatory T cells. CTLA4 is similar to the T-cell co-stimulatory protein, CD28, and both molecules bind to CD80 and CD86, also called B7-1 and B7-2 respectively, on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal. Fusion proteins of CTLA4 and antibodies (CTLA4-Ig) have been used in clinical trials for rheumatoid arthritis.

Reference:
Zhang L, Wang Y, Wang L, Wang M, Li S, He J, Ji J, Li K, Cao L. Identifying survival of pan-cancer patients under immunotherapy using genomic mutation signature with large sample cohorts. J Mol Med (Berl). 2023 Nov 18. Gnirck AC, Philipp MS, Waterhölter A, Wunderlich M, Shaikh N, Adamiak V, Henneken L, Kautz T, Xiong T, Klaus D, Tomczyk P, Al-Bahra MM, Menche D, Walkenhorst M, Lantz O, Willing A, Friese MA, Huber TB, Krebs CF, Panzer U, Kurts C, Turner JE. Mucosal-associated invariant T cells contribute to suppression of inflammatory myeloid cells in immune-mediated kidney disease. Nat Commun. 2023 Nov 15;14(1):7372.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
HA/Hemagglutinin ProteinStorage & Stability
Fc gamma RIIIA/CD16a Proteinsite
Popular categories:
Ubiquitin-Specific Peptidase 35
Protein Kinase Inhibitor Peptide (PKI)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer