Share this post on:

Name:
CD79B Protein

Synonyms:
CD79b; B29; IGB; Ig-beta

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P40259

Gene Id:
Ala29-Asp159ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGGGSHHHHHHHH

Molecular Weight:
26-35kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
CD79B encodes CD79b (also known as Igβ) belonging to the Ig superfamily, a transmembrane protein that associate with CD79a(Ig-α) via a disulfide bond. CD79a and CD79b encoded by the mb-1 and B29 genes, respectively. CD79A and CD79B are proximal B-cell receptor subunits that contain an immunoreceptor tyrosine-based activation motif (ITAM) that frequently harbors somatic mutations. Ig-α and Ig-β form a disulfide-linked heterodimer that associates with membrane-bound Ig (mIg)3 molecules of every Ig class to form the B cell Ag receptor (BCR) complex. The variable region of the H and L (IgH and IgL) chains of the mIg molecules constitute the Ag-binding portion of the BCR, whereas the Ig-α/Ig-β heterodimer is its signaling component. CD79b is ubiquitously expressed on the surface of mature B-cell lymphomas, including DLBCL.

Reference:
Venkitaraman, A. R., G. T. Williams, P. Dariavach, and M. S. Neuberger. 1991. The B-cell antigen receptor of the five immunoglobulin classes. Nature 352:777. 7. Campbell, K. S., E. J. Hager, R. J. Friedrich, and J. C. Cambier. 1991. IgM antigen receptor complex contains phosphoprotein products of B29 and mb-1 genes. Proc. Natl. Acad. Sci. USA 88:3982. Kim, K. M., G. Alber, P. Weiser, and M. Reth. 1993. Signalling function of the B-cell antigen receptors. Immunol. Rev. 132:125.Radaev, S, et al. (2010) Structure 18:934.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CKMT2 Proteinmedchemexpress
Alpha-FetoProteinmedchemexpress
Popular categories:
Influenza Non-structural Protein 2
Integrin alpha 5 beta 1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer