Share this post on:

Name:
Biotinylated GLP-1R Protein

Synonyms:
GLP-1 receptor; GLP1R; GLP-1R; GLP-1-R; glucagon-like peptide 1 receptor; MGC138331

Species Name:
Human

Label Name:
Avi Tag, His Tag

Marker Name:
Biotin

Accession:
P43220-1

Gene Id:
Ala21-Glu139 AGPRPQGATVSLWETVQKWREYRRQCQRSLTEDPPPATDLFCNRTFDEYACWPDGEPGSFVNVSCPWYLPWASSVPQGHVYRFCTAEGLWLQKDNSSLPWRDLSECEESKRGERSSPEEGGGSHHHHHHHHGLNDIFEAQKIEWHE

Molecular Weight:
25-33kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Glucagon-like peptide-1 receptor (GLP-1R) is a class B G-protein-coupled receptor. Human GLP-1R consists of an N-terminal, extracellular domain (ECD) containing 6 conserved cysteine residues and a transmembrane domain with seven membrane-spanning alpha-helices, characteristic of GPCRs. Activation of GLP-1R signaling regulates secretion of insulin from pancreatic beta -cells in a glucose-dependent manner. Glucagon-like peptide 1 receptor (GLP1R) signaling has been shown to have antipsychotic properties in animal models and to impact glucose-dependent insulin release, satiety, memory, and learning in man.

Reference:
1. Article Open Access Published: 09 March 2020Nature Communications volume 11, Article number: 1272 (2020) Cite this article.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FGF-21 Proteinmanufacturer
HMGB1/HMG-1 Proteinsupplier
Popular categories:
BTN3A1/CD277
Ring Finger Protein 43

Share this post on:

Author: Adenosylmethionine- apoptosisinducer