Share this post on:

Name:
Biotinylated FcRn Protein

Synonyms:
FcRn; FCGRT & B2M

Species Name:
Cynomolgus

Label Name:
Avi Tag, His Tag

Marker Name:
Biotin

Accession:
Q8SPV9(FcGRT)、Q8SPW0(B2M)

Gene Id:
Ala24-Ser297 (FcRn)&Ile21-Met119 (B2M)FcGRT:AESHLSLLYHLTAVSSPAPGTPAFWVSGWLGPQQYLSYDSLRGQAEPCGAWVWENQVSWYWEKETTDLRIKEKLFLEAFKALGGKGPYTLQGLLGCELSPDNTSVPTAKFALNGEEFMNFDLKQGTWGGDWPEALAISQRWQQQDKAANKELTFLLFSCPHRLREHLERGRGNLEWKEPPSMRLKARPGNPGFSVLTCSAFSFYPPELQLRFLRNGMAAGTGQGDFGPNSDGSFHASSSLTVKSGDEHHYCCIVQHAGLAQPLRVELETPAKSSGGGSGGGSHHHHHHHHhhGLNDIFEAQKIEWHEB2M:IQRTPKIQVYSRHPPENGKPNFLNCYVSGFHPSDIEVDLLKNGEKMGKVEHSDLSFSKDWSFYLLYYTEFTPNEKDEYACRVNHVTLSGPRTVKWDRDM\”

Molecular Weight:
33-40 &10-15kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
FcRn is an unusual Fc receptor, the biological importance of which is only beginning to be fully appreciated. In addition to its critical role in the transfer of maternal IgG to the fetus or neonate, FcRn is the homeostatic receptor responsible for extending the serum half-life of IgG in adults. The exact site(s) of IgG protection from degradation has not been delineated in vivo, but both endothelial cells and bone-marrow-derived cells can extend the serum persistence of IgG. FcRn is also expressed in many other tissues in the adult animal, including barrier sites such as the blood–brain interface, the glomerular filter in the kidneys and the intestinal epithelium. FcRn expression at these sites merits further study with the goals of modulating specific IgG transport to promote host defence or to control immune-complex deposition.

Reference:
1. Roopenian D. et al. (2007) FcRn: the neonatal Fc receptor comes of age. Nat Rev Immunol. 7: 715-725.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD163 Proteinsite
LOX-1/OLR1 Proteinmanufacturer
Popular categories:
TGF-alpha
Neural Cell Adhesion Molecule L1-Like Protein (CHL1)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer