Name:
OX40 Ligand/TNFSF4 Protein
Synonyms:
OX40L; TNFSF4; CD252; Glycoprotein Gp34; TXGP1; CD134 ligand; CD134L
Species Name:
Cynomolgus
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
A0A1D5QQH7
Gene Id:
Gln51-Leu183HHHHHHHHGGGSQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL
Molecular Weight:
20-27kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
OX40 is a member of the TNF receptor family, which is mainly known to promote effector T cell differentiation, proliferation, long-term survival, and pro-infammatory cytokines production, while inhibiting differentiation and suppressive activity of regulatory T cells (Tregs). It is expressed on activated CD4+ and CD8+ T cells, as well as on other cell types. The OX40 ligand, expressed by antigen presenting cells (APC), activates the OX40 signaling pathway which promotes a robust immune response. The interaction of OX40 with OX40 ligand results in enhanced CD4+ and CD8+ cell proliferation, stimulated cytokine production, and increased survival of antigen specific memory T cell. OX40 expression was revealed as an unfavorable prognostic marker and might be a target for immunotherapy in the future. OX40 was identified as a novel molecule in EC; its elevated expression tends to signify favorable clinical outcomes. As a second immune checkpoint, OX40 may have potential implications for the prognosis and immunomodulation of EC patients. In mice, the absence of OX40 has been shown to cause a strong reduction in the number of effector memory CD4+ cells. Furthermore, the CD8+ response was reduced and tumor growth was accelerated. Accordingly, it is comprehensible that the immune-stimulating properties of OX40 agonists could overcome some of the immunosuppressive properties within tumor environment.
Reference:
1.J Leukoc Biol . 1998 Oct;64(4):503-10. doi: 10.1002/jlb.64.4.503.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Coagulation Factor IX/F9 ProteinStorage & Stability
Stathmin ProteinBiological Activity
Popular categories:
Dengue Virus Proteins
BTN2A2