Share this post on:

Name:
OX40 Ligand/TNFSF4 Protein

Synonyms:
OX40L; TNFSF4; CD252; Glycoprotein Gp34; TXGP1; CD134 ligand; CD134L

Species Name:
Cynomolgus

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
A0A1D5QQH7

Gene Id:
Gln51-Leu183HHHHHHHHGGGSQVSHQYPRIQSIKVQFTEYKKEEGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMVASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL

Molecular Weight:
20-27kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
OX40 is a member of the TNF receptor family, which is mainly known to promote effector T cell differentiation, proliferation, long-term survival, and pro-infammatory cytokines production, while inhibiting differentiation and suppressive activity of regulatory T cells (Tregs). It is expressed on activated CD4+ and CD8+ T cells, as well as on other cell types. The OX40 ligand, expressed by antigen presenting cells (APC), activates the OX40 signaling pathway which promotes a robust immune response. The interaction of OX40 with OX40 ligand results in enhanced CD4+ and CD8+ cell proliferation, stimulated cytokine production, and increased survival of antigen specific memory T cell. OX40 expression was revealed as an unfavorable prognostic marker and might be a target for immunotherapy in the future. OX40 was identified as a novel molecule in EC; its elevated expression tends to signify favorable clinical outcomes. As a second immune checkpoint, OX40 may have potential implications for the prognosis and immunomodulation of EC patients. In mice, the absence of OX40 has been shown to cause a strong reduction in the number of effector memory CD4+ cells. Furthermore, the CD8+ response was reduced and tumor growth was accelerated. Accordingly, it is comprehensible that the immune-stimulating properties of OX40 agonists could overcome some of the immunosuppressive properties within tumor environment.

Reference:
1.J Leukoc Biol . 1998 Oct;64(4):503-10. doi: 10.1002/jlb.64.4.503​.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Coagulation Factor IX/F9 ProteinStorage & Stability
Stathmin ProteinBiological Activity
Popular categories:
Dengue Virus Proteins
BTN2A2

Share this post on:

Author: Adenosylmethionine- apoptosisinducer