Name:
Biotinylated ROR1 Protein
Synonyms:
ROR1, NTRKR1
Species Name:
Human/Cynomolgus/Rhesus macaque
Label Name:
Human Fc Tag
Marker Name:
Biotin
Accession:
Q01973-1
Gene Id:
Gln30-Glu403QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKMEGGGSGGGSHHHHHHHHHHGLNDIFEAQKIEWHE
Molecular Weight:
60-70kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
Receptor tyrosine kinase-like orphan receptors (RORs) are monotopic membrane proteins belonging to the receptor tyrosine kinase (RTK) family. RTKs play a role in the control of most basic cellular processes, including cell proliferation, differentiation, migration and metabolism. ROR1 contains 1 FZ (frizzled) domain, 1 Ig-like C2-type (immunoglobulin-like) domain, 1 kringle domain, 1 protein kinase domain. ROR1 is highly expressed in a wide variety of hematological and solid cancers, but is low or absent in adult tissues. ROR1 could interact with casein kinase 1 epsilon (CK1ε) to activate phosphoinositide 3-kinase-mediated AKT phosphorylation and cAMP-response-element-binding protein (CREB). Studies have demonstrated that it plays an important role in oncogenesis by activating cell survival signaling events, particularly the non-canonical WNT signaling pathway. Antibody-based immunotherapies targeting ROR1 have been developed and evaluated in preclinical and clinical studies with promising outcomes.
Reference:
1. María Josefina Quezada, Pablo Lopez-Bergami. (2023). The signaling pathways activated by ROR1 in cancer. Cell Signal. 104:110588.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SFRP2 Protein
AlkB Protein
Popular categories:
Activin AB
GSK-3 beta
