Share this post on:

Name:
SFTPD Protein

Synonyms:
SP-D; PSP-D; SFTP4; COLEC7

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P35247

Gene Id:
Ala21-Phe375AEMKTYSHRTMPSACTLVMCSSVESGLPGRDGRDGREGPRGEKGDPGLPGAAGQAGMPGQAGPVGPKGDNGSVGEPGPKGDTGPSGPPGPPGVPGPAGREGPLGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSAGARGLAGPKGERGVPGERGVPGNTGAAGSAGAMGPQGSPGARGPPGLKGDKGIPGDKGAKGESGLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGQSVGEKIFKTAGFVKPFTEAQLLCTQAGGQLASPRSAAENAALQQLVVAKNEAAFLSMTDSKTEGKFTYPTGESLVYSNWAPGEPNDDGGSEDCVEIFTNGKWNDRACGEKRLVVCEFGGGSHHHHHHHH

Molecular Weight:
37-47kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Surfactant Protein D (SP-D, gene name: SFTPD) is a pattern recognition molecule belonging to the family of collections expressed in multiple human organ systems, including the lungs. SFTPD is located at the genomic position 10q22.2‐23.1. In addition to the respiratory system, SFTPD is also expressed in several other tissues/organs, such as the brain, pancreas, kidney, gut, endothelium, and reproductive system. SFTPD was initially identified to be expressed and secreted in lung alveolar epithelial type II cells and plays a crucial role in protecting the lung from inhaled microorganisms, organic antigens, and toxins by recruiting the innate immune system and consequently regulating inflammatory activities. SFTPD is a critical component of the innate immune system intrinsically linked to energy metabolism. SFTPD plays an important role in the innate immune system by binding bacteria, viruses, fungi, and parasites for clearance via opsonization in phagocytes, as well as aiding in the removal of allergens.

Reference:
1.Kuroki Y, Voelker DR. Pulmonary surfactant proteins. J Biol Chem. 1994; 269:25943–25946. doi: 10.1016/S0021-9258(18)47138-4. 2.Sano H, Kuroki Y. The lung collectins, SP-A and SP-D, modulate pulmonary innate immunity. Mol Immunol. 2005; 42:279–287. 3.Hu F, Ding G, Zhang Z, Gatto LA, Hawgood S, Poulain FR, et al. Innate immunity of surfactant proteins A and D in urinary tract infection with uropathogenic escherichia coli. J Innate Immun. 2015; 22:9–20.4.Liu Z, Shi Q, Liu J, Abdel-Razek O, Xu Y, Cooney RN, et al. Innate immune molecule surfactant protein d attenuates sepsis-induced acute pancreatic injury through modulating apoptosis and NF-κB-mediated Inflammation. Sci Rep. 2015; 5:17798. 5.Stahlman MT, Gray ME, Hull WM, Whitsett JA. Immunolocalization of surfactant protein-D (SP-D) in human fetal, newborn, and adult tissues. J Histochem Cytochem. 2002; 50:651–660.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OX40/TNFRSF4 Protein
Legumain Protein
Popular categories:
Carboxypeptidase A3
EphA6

Share this post on:

Author: Adenosylmethionine- apoptosisinducer