Name:
FcRL1/CD307a Protein
Synonyms:
FcR-like protein 1, FcRL1, Fc receptor homolog 1 (FcRH1), CD307a
Species Name:
Human
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q96LA6
Gene Id:
Ala17-Asn303AELFLIASPSHPTEGSPVTLTCKMPFLQSSDAQFQFCFFRDTRALGPGWSSSPKLQIAAMWKEDTGSYWCEAQTMASKVLRSRRSQINVHRVPVADVSLETQPPGGQVMEGDRLVLICSVAMGTGDITFLWYKGAVGLNLQSKTQRSLTAEYEIPSVRESDAEQYYCVAENGYGPSPSGLVSITVRIPVSRPILMLRAPRAQAAVEDVLELHCEALRGSPPILYWFYHEDITLGSRSAPSGGGASFNLSLTEEHSGNYSCEANNGLGAQRSEAVTLNFTVPTGARSNGGGSGGGSHHHHHHHHHH
Molecular Weight:
37-49kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
Fc receptor-like (FCRL) belongs to the Fc receptor-like (FcRL) family. The FCRL genes are located on chromosome 1q21-23 and encode 2 intracellular proteins (FCRL-A and B) and 6 transmembrane receptors with 3-9 immunoglobulin (Ig-like domains-in extracellular region (FcRL1-6). In addition, the FcRL gene family contained six members with FcRL1, FcRL2, FcRL3, FcRL4, FcRL5 and FcRL6. Among the FcRL receptors, FcRL1 has 2 ITAM-like components in the cytoplasmic tail and residual glutamic acids with negative charges its transmembrane region. FcRL1–5 was significantly expressed by B cells. FcRL6 was expressed by T cells and NK cells. To date, the FcRL gene expression has been extensively assessed in human malignancies involving mantle cell lymphoma and multiple myeloma. The structural features and expression pattern of FcRL1 in B-lineage cells suggest that it may act as an activation receptor in human B cell or plays a significant role in the pathogenesis of B-cell-related disorders. Nowadays, increasing researches have been provided many evidences which demonstrated that FcRL gene polymorphisms, especially FcRL3, were associated with various autoimmune diseases including AS and RA.
Reference:
1. Davis, R.S. et al. (2007) Annu. Rev. Immunol. 25:525.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
TIGIT Protein
SMYD3 Protein
Popular categories:
SMAD3
Neurotrophin-3
