Name:
IL-23 Protein
Synonyms:
Interleukin-23蛋白；IL-23蛋白;SGRF；IL-23p19；CLMF p40；IL-12 subunit p40；NKSF2
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
Gene Id:
Val22-Ala196&Met23-Ser335VPRSSSPDWAQCQQLSRNLCMLAWNAHAPAGHMNLLREEEDEETKNNVPRIQCEDGCDPQGLKDN SQFCLQRIRQGLAFYKHLLDSDIFKGEPALLPDSPMEQLHTSLLGLSQLLQPEDHPRETQQMPSL SSSQQWQRPLLRSKILRSLQAFLAIAARVFAHGAATLTEPLVPTA&MWELEKDVYVVEVDWTPDA PGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGG
Molecular Weight:
19.7&35.8 KDa
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<1EU/μg
Reconstitution:
Always centrifuge tubes before opening. \nDo not mix by vortex or pipetting. \nIt is not recommended to reconstitute to a concentration less than 100 μg/ml. \nDissolve the lyophilized protein in distilled water. \nPlease aliquot the reconstituted solution to minimize freeze-thaw cycles.
Stability Storage:
Lyophilized protein should be stored at Reconstituted protein solution can be stored at 4°C for 2-7 days.Aliquots of reconstituted samples are stable at
Buffer System:
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Quality Statement:
Interleukin 23 (IL-23) is a heterodimeric cytokine composed of two disulfide-linked subunits, a p19 subunit that is unique to IL-23, and a p40 subunit that is shared with IL-12. The p19 subunit has homology to the p35 subunit of IL-12, as well as to other single chain cytokines such as IL-6 and IL-11. The p40 subunit is homologous to the extracellular domains of the hematopoietic cytokine receptors. Although p19 is expressed by activated macrophages, dendritic cells, T cells, and endothelial cells, only activated macrophages and dendritic cells express p40 concurrently to produce IL-23. IL-23 has biological activities that are similar to, but distinct from IL-12. Both IL-12 and IL-23 induce proliferation and IFN-gamma production by human T cells. While IL-12 acts on both naive and memory human T cells, the effects of IL-23 is restricted to memory T cells.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-31 Protein
VEGF165 Protein
Popular categories:
GSK-3 alpha
PDGF-R-beta
