Share this post on:

Name:
TGF-β1 Protein

Synonyms:
TGFβ1蛋白;TGFB1蛋白;TGF-beta-1; CED; DPD1; TGFB; TGF-b1; TGFB1; CEDLAP; latency-associated peptide; TGFbeta; TGF-beta 1 protein; transforming growth factor beta-1

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P04202

Gene Id:
Ala279-Ser390ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALY NQHNPGASASPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Molecular Weight:

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in 4mM Hcl. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Stability Storage:
Lyophilized protein should be stored at

Buffer System:
Lyophilized from a 0.2 μm filtered solution of 4mM Hcl

Quality Statement:
Transforming growth factor beta 1 (TGFβ1) is the prototype of a growing superfamily of peptide growth factors and plays a prominent role in a variety of cellular processes, including cell-cycle progression, cell differentiation, reproductive function, development, motility, adhesion, neuronal growth, bone morphogenesis, wound healing, and immune surveillance. TGF-β1, TGF-β2 and TGF-β3 signal via the same heteromeric receptor complex, consisting of a ligand binding TGF-β receptor type II (TβR-II), and a TGF-β receptor type I (TβR-I). Signal transduction from the receptor to the nucleus is mediated via SMADs. TGF-β expression is found in cartilage, bone, teeth, muscle, heart, blood vessels, haematopoitic cells, lung, kidney, gut, liver, eye, ear, skin, and the nervous system.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-1R2 Protein
MAG/Siglec-4a Protein
Popular categories:
Nuclear Receptor Superfamily
CD185/CXCR5

Share this post on:

Author: Adenosylmethionine- apoptosisinducer