Share this post on:

Name:
Saposin-A Protein

Synonyms:
Proactivator polypeptide; Saposin-A; PSAP; GLBA; SAP1

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
P07602

Gene Id:
Ser60-Ser140MHHHHHHSSGVDLGTENLYFQSMGSLPCDICKDVVTAAGDMLKDNATEEEILVYLEKTCDWLPKPNMSASCKEIVDSYLPVILDIIKGEMSRPGEVCSALNLCES

Molecular Weight:
10kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Liquid

Endotoxin Name:
<1EU/μg

Reconstitution:

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20 mM HEPES, 150 mM NaCl, pH 7.5 \n

Quality Statement:
Saposin-A is a highly conserved glycoprotein which is a precursor for 4 cleavage products: saposins A, B, C, and D, which are similar to each other and are sphingolipid hydrolase activator proteins. Each domain of the precursor protein is approximately 80 amino acid residues long with nearly identical placement of cysteine residues and glycosylation sites. Saposins A-D localize primarily to the lysosomal compartment where they facilitate the catabolism of glycosphingolipids with short oligosaccharide groups. The precursor protein exists both as a secretory protein and as an integral membrane protein and has neurotrophic activities.

Reference:
1. 2020 Feb;129(2):161-164. doi: 10.1016/j.ymgme.2019.08.001. Epub 2019 Aug 5.2. 2013 Jun 15;22(12):2435-50. doi: 10.1093/hmg/ddt096. Epub 2013 Feb 27

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Clusterin/APOJ Protein
Insulin-like 3/INSL3 Protein
Popular categories:
Serpin E3
Stimulatory Immune Checkpoint Molecules

Share this post on:

Author: Adenosylmethionine- apoptosisinducer