Share this post on:

Name:
MIP-1α/CCL3 Protein

Synonyms:
C-C motif chemokine 3, MIP-1-alpha, Macrophage inflammatory protein 1-alpha, LD78-alpha

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P10147

Gene Id:
Ser24-Ala92SLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKPGVIFLTKRSRQVCADPSEEWVQKYVSDLELSA

Molecular Weight:
10kDa (Reducing)

Purity:
>95% by SDS-PAGE & RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to-70 °C as supplied. ·1 month, 2 to 8 °C under sterileconditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Chemokines are a class of cytokines that can cause cells to undergochemotactic movement, and their main role in the body is in chemotactic cellmigration. They are widely expressed in various tissues and cells of the body,and their receptors are mainly expressed in white blood cells, mediating thedirectional migration of white blood cells to play a biological role. CCL3, oneof the components of the chemokinep CC ligand family was also termed as MIP(macrophage inflammatory protein). It can be expressed on the surface ofmacrophages, lymphocytes, epithelial cells, and other cells. It mediates thesecretion of cytokines by immune cells and promotes the aggregation andmigration of a variety of cells. C-C motif chemokine receptor 1 (CCR1) and CCR5are the receptors of CCL3.C-C motif chemokine ligand 3 (CCL3) belongs toinflammatory cell chemokine. CCL3 or macrophageinflammatory protein-1α (MIP-1α), an important chemokine implicated in bothimmune surveillance and tolerance, has emerged as a prognostic biomarker inboth solid and hematological malignancies.

Reference:
1.RheumatolTher. 2023 Aug;10(4):793-808. doi: 10.1007/s40744-023-00554-0. Epub 2023 May25.2.AdvExp Med Biol. 2020:1231:13-21. doi: 10.1007/978-3-030-36667-4_2. 3.Contrast Media Mol Imaging. 2022 Jul 12:2022:2387192.doi: 10.1155/2022/2387192. eCollection 2022.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
VE-Cadherin Protein
Legumain Protein
Popular categories:
Cystatin-2
IFN-alpha 10

Share this post on:

Author: Adenosylmethionine- apoptosisinducer