Name:
CTLA-4/CD152 Protein
Synonyms:
Celiac Disease 3,Ligand And Transmembrane Spliced Cytotoxic T Lymphocyte Associated Antigen 4,Cytotoxic T-Lymphocyte Protein 4,CD152,Cytotoxic T-lymphocyte-associated antigen 4,CTLA4,CTLA-4,Cytotoxic T-Lymphocyte Associated Protein 4,Insulin-Dependent Diabetes Mellitus 12,Cytotoxic T Lymphocyte Associated Antigen 4 Short Spliced Form,Cytotoxic T-Lymphocyte-Associated Serine Esterase-4,CD152 Isoform,CD152 Antigen,CELIAC3,IDDM12,ALPS5,GRD4,GSE,CD,CTLA-4 Antigen
Species Name:
Rabbit
Label Name:
Human Fc Tag
Marker Name:
Unconjugated
Accession:
P42072
Gene Id:
Lys36-Asp161KALHVSQPAVVLASSRGVASFVCEYASSHKATEVRVTVLRQANSQMTEVCAMTYTVENELTFIDDSTCTGISHGNKVNLTIQGLSAMDTGLYICKVELMYPPPYYVGMGNGTQIYVIEPEPCPDSDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Molecular Weight:
45-50kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
Cytotoxic T-lymphocyte-associated protein 4 (CTLA-4) is an inhibitory receptor belonging to the CD28 immunoglobulin subfamily, expressed primarily by T-cells. The family includes CD28, CTLA-4 and ICOS as well as other proteins including PD-1, BTLA and TIGIT.Its ligands, CD80 and CD86, are typically found on the surface of antigen-presenting cells and can either bind CD28 or CTLA-4, resulting in a costimulatory or a co-inhibitory response, respectively. Because of its dampening effect, CTLA-4 is a crucial regulator of T-cell homeostasis and self-tolerance. The mechanisms by which CTLA-4 exerts its inhibitory function can be categorized as either cell-intrinsic (affects the CTLA-4 expressing T-cell) or cell-extrinsic (affects secondary cells). CTLA-4 mainly acts in a cell-extrinsic manner via its competition with CD28, CTLA-4-mediated trans-endocytosis of CD80 and CD86, and its direct tolerogenic effects on the interacting cell.
Reference:
1.Shuang Qin, Linping Xu, Ming Yi, Shengnan Yu,Kongming Wu & Suxia Luo: Novel immune checkpoint targets: moving beyondPD-1 and CTLA-4: MolecularCancer volume 18, Article number: 155 (2019).
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
ACAT2 Protein
Grancalcin/GCA Protein
Popular categories:
Steroidogenic Factor 1
Junctional Adhesion Molecule B (JAM-B)