Share this post on:

Name:
Biotinylated Fc γ RIIIb/CD16b Protein

Synonyms:
Fc gamma RIIIB, CD16b (NA2), FCGR3B, CD16B, FCG3B, FCGR3, FCG3, IGFR3

Species Name:
Human

Label Name:
Avi Tag, His Tag

Marker Name:
Unconjugated

Accession:
AAA35881.1

Gene Id:
Gly17-Ser200 GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGSGGGSHHHHHHHHHHGLNDIFEAQKIEWHE

Molecular Weight:
40-52kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Receptors for the Fc region of IgG (Fc gamma R) are members of the Ig superfamily. Based on their genetic organization and molecular structure, three classes of human Fc γ Rs can be identified: RI (CD64), RII (CD32), and RIII (CD16), which produce a variety of isoforms. Fc γ RI is a high-affinity receptor that binds monomeric IgG. Both Fc γ RII and RIII are low-affinity receptors that bind IgG as immune complexes. Two genes have been identified for human Fc γ RIII, A and B, which encode a transmembrane receptor and a glycosylphosphatidylinositol (GPI) anchored protein, respectively. Three allelic variants of Fc γ RIIIB, NA-1, NA-2, and SH were present. CD16 inhibits a variety of cellular functions such as B cell activation/proliferation and mast cell degranulation, cannot mediate antibody-dependent cytotoxicity and phagocytosis, acts as a trap for peripheral circulating immune complexes, and binds IgG complexes but does not activate neutrophils. CD16 regulates the inflammatory process by interacting with CR3 and CR4 and inducing IL-6 and IL-8 production by monocytes.

Reference:
1. Yue Wang, Jianming Wu, Robert Newton, Nooshin S. Bahaie, Chunmei Long, Bruce Walcheck: ADAM17 cleaves CD16b (FcγRIIIb) in human neutrophils. Biochimica et Biophysica Acta (BBA) – Molecular Cell Research, Volume 1833, Issue 3, March 2013, Pages 680-685.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B7-1/CD80 Protein
RBP4 Protein
Popular categories:
FGF-22
Complement Component 3b

Share this post on:

Author: Adenosylmethionine- apoptosisinducer