Name:
Biotinylated Fc γ RIIIb/CD16b Protein
Synonyms:
Fc gamma RIIIB, CD16b (NA2), FCGR3B, CD16B, FCG3B, FCGR3, FCG3, IGFR3
Species Name:
Human
Label Name:
Avi Tag, His Tag
Marker Name:
Unconjugated
Accession:
AAA35881.1
Gene Id:
Gly17-Ser200 GMRTEDLPKAVVFLEPQWYSVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVNDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGSGGGSHHHHHHHHHHGLNDIFEAQKIEWHE
Molecular Weight:
40-52kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
Receptors for the Fc region of IgG (Fc gamma R) are members of the Ig superfamily. Based on their genetic organization and molecular structure, three classes of human Fc γ Rs can be identified: RI (CD64), RII (CD32), and RIII (CD16), which produce a variety of isoforms. Fc γ RI is a high-affinity receptor that binds monomeric IgG. Both Fc γ RII and RIII are low-affinity receptors that bind IgG as immune complexes. Two genes have been identified for human Fc γ RIII, A and B, which encode a transmembrane receptor and a glycosylphosphatidylinositol (GPI) anchored protein, respectively. Three allelic variants of Fc γ RIIIB, NA-1, NA-2, and SH were present. CD16 inhibits a variety of cellular functions such as B cell activation/proliferation and mast cell degranulation, cannot mediate antibody-dependent cytotoxicity and phagocytosis, acts as a trap for peripheral circulating immune complexes, and binds IgG complexes but does not activate neutrophils. CD16 regulates the inflammatory process by interacting with CR3 and CR4 and inducing IL-6 and IL-8 production by monocytes.
Reference:
1. Yue Wang, Jianming Wu, Robert Newton, Nooshin S. Bahaie, Chunmei Long, Bruce Walcheck: ADAM17 cleaves CD16b (FcγRIIIb) in human neutrophils. Biochimica et Biophysica Acta (BBA) – Molecular Cell Research, Volume 1833, Issue 3, March 2013, Pages 680-685.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B7-1/CD80 Protein
RBP4 Protein
Popular categories:
FGF-22
Complement Component 3b