Share this post on:

Name:
Biotinylated Fc γ RIIIa/CD16a Protein

Synonyms:
CD16-II, CD16a antigen, FcR-10

Species Name:
Human

Label Name:
Avi Tag, His Tag

Marker Name:
Unconjugated

Accession:
P08637

Gene Id:
Gly17-Gln208GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQGGGSGGGSGLNDIFEAQKIEWHEHHHHHHHHHH

Molecular Weight:
40-45kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Fc gamma RIIIa is a low/intermediate affinity receptor for polyvalent immune-complexed IgG. It is involved in phagocytosis, secretion of enzymes and inflammatory mediators, antibody-dependent cytotoxicity and clearance of immune complexes. In humans, it is a 50-70 kDa type I transmembrane activating receptor expressed by NK cells, T cells, monocytes, and macrophages. A single nucleotide polymorphism creates high binding (V176) and low binding (F176) forms that, when homozygous, may influence susceptibility to autoimmune diseases or response to therapeutic IgG antibodies. Aberrant expression or mutations of CD16a is implicated in susceptibility to recurrent viral infections, systemic lupus erythematosus, and alloimmune neonatal neutropenia.

Reference:
1. Nimmerjahn, F. and J.V. Ravetch: Fcgamma receptors: old friends and new family members , Immunity Jan;24(1):19-28(2006).2. Ravetch, J.V. and B. Perussia : Alternative membrane forms of Fc gamma RIII(CD16) on human natural killer cells and neutrophils. Cell type-specific expression of two genes that differ in single nucleotide substitutions , J. Exp. Med. 170:481(1989).

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Agrin Protein
CD3 delta Protein
Popular categories:
IgA
L-Selectin/CD62L

Share this post on:

Author: Adenosylmethionine- apoptosisinducer