Name:
Biotinylated B7-H3/CD276 Protein
Synonyms:
B7-H3, CD276, B7H3, B7-H3, CD276 antigen, CD276 molecule, CD276, B7H34Ig-B7-H3, B7-H3B7 homolog 3, Costimulatory molecule
Species Name:
Mouse
Label Name:
Avi Tag, His Tag
Marker Name:
Unconjugated
Accession:
Q8VE98
Gene Id:
Val29-Phe244VEVQVSEDPVVALVDTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYSNRTALFPDLLVQGNASLRLQRVRVTDEGSYTCFVSIQDFDSAAVSLQVAAPYSKPSMTLEPNKDLRPGNMVTITCSSYQGYPEAEVFWKDGQGVPLTGNVTTSQMANERGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPLTFGGGSGGGSHHHHHHHHHHGLNDIFEAQKIEWHE
Molecular Weight:
40-45kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
B7-h3 (B7 homolog 3 protein), also known as CD276, is an important immune checkpoint molecule in the B7-CD28 family. It is a type I transmembrane glycoprotein consisting of 316 amino acids and contains a putative 28AA signal peptide, a 217AA extracellular region composed of immunoglobulin constant (IgC) and variable (IgV) structures, a transmembrane region, and a 45-amino acid cytoplasmic domain.B7-H3 is a T cell co-suppressor molecule with partial co-stimulatory function. B7-H3 can effectively inhibit the function of T cells and NK cells, and also play a role in bone development. The expression of B7-H3 is low in normal tissues and is found in a variety of malignant tumors, which is closely related to the growth, metastasis, recurrence and poor prognosis of malignant tumors. B7-H3 can down-regulate T-assisted type 1 mediated immune response, inhibit CD4+T cell activation and inhibit cytokine production, and thus may play a role in promoting immune escape of cancer cells.
Reference:
1. Jie Liu, Shuo Yang, Bihui Cao, Guangyu Zhou, Fengjuan Zhang, Yuan Wang, Rixin Wang, Lipeng Zhu, Ya Meng, Cong Hu, Hui Liang, Xu Lin, Kangshun Zhu, Guokai Chen, Kathy Qian Luo, Lijun Di & Qi Zhao: Targeting B7-H3 via chimeric antigen receptor T cells and bispecific killer cell engagers augments antitumor response of cytotoxic lymphocytes, Journal of Hematology & Oncology, 29 January 2021.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Apolipoprotein A-I/APOA1 Protein
RBP4 Protein
Popular categories:
CD93
IgG2A
