Share this post on:

Name:
CD58/LFA-3 Protein

Synonyms:
CD58, LFA3, Ag3

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
AAH05930.1

Gene Id:
Phe29-Arg215 FSQQIYGVVYGNVTFHVPSNVPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTVSGSLTIYNLTSSDEDEYEMESPNITDTMKFFLYVLESLPSPTLTCALTNGSIEVQCMIPEYYNSHRGLIMYSWDCPMEQCKRNSTSIYFKMENDLPQKIQCTLSNPLFNTTSSIILTTCIPSSGHSRHRGGGSHHHHHHHH

Molecular Weight:
33-55kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
CD58, also known as lymphocyte function-associated antigen (LFA-3), is a 210 amino acid protein that belongs to the CD2 family of the immunoglobulin superfamily. CD58 is widely expressed on hematopoietic and non-hematopoietic human tissue and has been found on leukocytes, erythrocytes, endothelial cells, epithelial cells and fibroblasts of human origin. CD58 /LFA3 is ligand of the T-lymphocyte CD2 glycoprotein, which binds to CD2 (LFA-2) on T cells and is important in strengthening the adhesion between the T cells and Professional Antigen Presenting Cells.

Reference:
Smith, M.E. and J.A. Thomas (1990) J. Clin. Pathol. 43:893.Bolhuis, R.L. Roozemond, R.C. and R.J. van de Griend (1986) J. Immunol. 136:3939.Crawford, K. et al. (2003) Blood 102:1745.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
FKBP12 Protein
B7-2/CD86 Protein
Popular categories:
CD52
Cannabinoid Receptor

Share this post on:

Author: Adenosylmethionine- apoptosisinducer