Fc γ RIIIb/CD16b Protein | Adenosylmethionine

Name:
Fc γ RIIIb/CD16b Protein

Synonyms:
Fc γ RIIIb, CD16b(NA1);Low affinity immunoglobulin gamma Fc region receptor III-B, Fc-gamma RIII-beta, FcR-10, IgG Fc receptor III-1, FCG3, FCGR3, CD16b and FCGR3B.

Species Name:
Human

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
O75015

Gene Id:
GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNENLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHVGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKDRKYFHHNSDFHIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISGGGSGGGSHHHHHHHHHH

Molecular Weight:
33-40 kDa(Reducing)

Purity:
＞95%, by SDS-PAGE under reducing conditions

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4, 5% trehalose

Quality Statement:
IgG Fc receptor (Fc γ R) is a member of the Ig superfamily, which plays a role in activating or inhibiting immune response. Human Fc γ Rs is identified as three types: RI (CD64), RII (CD32) and RIII (CD16). CD16 is a low-affinity Fc receptor, which has been identified as Fc receptor Fc γ RIII (a (CD16a) and Fc γ RIIIb (CD16b). These receptors bind to the Fc portion of the IgG antibody and are encoded by two different highly homologous genes in a cell type-specific manner. CD16b, also known as FCGR3b and FCG3b, is specifically expressed by neutrophils and stimulated eosinophils. CD16b is a low affinity receptor of immunoglobulin Fc γ region. CD16b binds composite or aggregated IgG and monomer IgG. CD16b could not mediate antibody-dependent cytotoxicity and phagocytosis.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
LDLRAD3 Protein
HSP70/HSPA1A Protein
Popular categories:
ANG-2
Complement Factor B

Author: Adenosylmethionine- apoptosisinducer

Related Posts