Name:
IL-13 Protein
Synonyms:
Interleukin-13, ALRH Protein, Human; IL-13 Protein, Human; P600 Protein, Human
Species Name:
Mouse
Label Name:
No Tag
Marker Name:
Unconjugated
Accession:
P20109
Gene Id:
Ser26-Phe131SVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFITKLLSYTKQLFRHGPF
Molecular Weight:
12kDa (Reducing)
Purity:
＞95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
20mM PB, 300mM NaCl, pH6.0
Quality Statement:
IL-13 is the signature cytokine of the type II inflammatory response. It is key player in the inflammatory response triggered either by an invading parasite or allergen. The cellular sources of IL-4 and IL-13 have been studied extensively and along with CD4 T cells, basophils, eosinophils, mast cells, and NK T cells, appropriately stimulated ILC2 cells have the ability to produce IL-4 and IL-13. IL-13 belong to the T helper 2 (Th2) cytokine family, along with IL-3, IL-5, and IL-9. These cytokines are key mediators of allergic inflammation. They have important immunomodulatory activities and exert influence on a wide variety of immune cells, such as B cells, eosinophils, basophils, monocytes, fibroblasts, endothelial cells, airway epithelial cells, smooth muscle cells, and keratinocytes.
Reference:
1.\tCells. 2021 Nov 3;10(11):3000. doi: 10.3390/cells10113000. 2.\tFront Immunol. 2018 Jun 7:9:888. doi: 10.3389/fimmu.2018.00888. eCollection 2018.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Glypican-1/GPC1 Protein
Prolactin R Protein
Popular categories:
VEGF
Toll Like Receptor 2
