Share this post on:

Name:
GRO beta/CXCL2 Protein

Synonyms:
rHuGRO-β/CXCL2; C-X-C motif chemokine 2; MIP2-alpha; HSF

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P19875

Gene Id:
Ala35-Asn107APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN

Molecular Weight:
9kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 300mM NaCl, pH8.0

Quality Statement:
Chemokines are small proteins (8–10 kDa) which direct the movement of leukocytes, including hematopoietic stem and progenitor cells, and can mobilize hematopoietic cells from marrow to peripheral blood where they can be used for transplantation,specialized in attracting inflammatory and structural cells to the sites of injury. GROs belong to the CXC family of chemokines bearing motif, glutamic acid, leucine, and arginine (R). In addition to GROs, this family also comprises epithelium-derived neutrophil activating peptide 78 (CXCL5), granulocyte chemotactic protein 2 (CXCL6), neutrophil-activating peptide 2 (CXCL7), and IL-8 (CXCL8). CXCL1, CXCL2, and CXCL3 are well known as powerful neutrophil chemoattractants and are involved in cancer metastasis, angiogenesis, and wound healing. Recently, GROs have been postulated to play a role in asthma severity and asthmatic airway remodeling.

Reference:
1.\tLaila A Al-Alwan, Ying Chang (2013) J Immunol. 191(5):2731-41.2.\tLouis M Pelus 1, Seiji Fukuda (2006) Exp Hemato. 34(8):1010-20.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
B7-2/CD86 Protein
CD21 Protein
Popular categories:
IL-20R alpha
FcγRIIIA/CD16a

Share this post on:

Author: Adenosylmethionine- apoptosisinducer