Name:
SLAMF1/SLAM/CD150 Protein
Synonyms:
CDw150,SLAM,IPO-3
Species Name:
Mouse
Label Name:
His Tag
Marker Name:
Unconjugated
Accession:
Q9QUM4-1
Gene Id:
Thr25-Pro242TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPGGGSHHHHHHHH
Molecular Weight:
40-55kDa (Reducing)
Purity:
>95% by SDS-PAGE
Physical Appearance Name:
Lyophilized Powder
Endotoxin Name:
<0.1EU/μg
Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.
Buffer System:
PBS, pH7.4.
Quality Statement:
The type I transmembrane glycoprotein Signaling Lymphocytic Activation Molecule (SLAM), also known as CD150, is the prototypic member of the SLAM subgroup of the CD2 protein family. Alternate splicing generates an isoform with a substituted cytoplasmic domain. SLAM is expressed on T cells, B cells, thymocytes, macrophages, dendritic cells, platelets, and hematopoietic stem cells. It is up‑regulated on activated B cells and CD4+ and CD8+ T cells, although it is down‑regulated on Th2 polarized cells. SLAM interacts homophilically with low affinity, and this interaction induces a Th0/Th1 response characterized by clonal expansion, production of IFN-gamma, and increased cytolytic activity of CD8+ T cells. SLAM ligation also promotes B cell activation, allergen-induced eosinophil and mast cell activation, NKT cell development, and the microbicidal response of macrophages to Gram negative bacteria. In humans, SLAM functions as a cellular entry receptor for measles virus.
Reference:
1.Castro, A.G. et al. (1999) J. Immunol. 163:5860.2.Cocks, B.G. et al. (1995) Nature 376:260.3.Wang, N. et al. (2004) J. Exp. Med. 199:1255.4.Hahm, B. et al. (2004) Virology 323:292.5.Nanda, N. et al. (2005) Blood 106:3028.6.Kiel, M.J. et al. (2005) Cell 121:1109.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Neurotrophin-4 Protein
METRNL/Meteorin-like Protein
Popular categories:
Brutons Tyrosine Kinase (BTK)
Myelin Associated Glycoprotein (MAG/Siglec-4a)