Share this post on:

Name:
SLAMF1/SLAM/CD150 Protein

Synonyms:
CDw150,SLAM,IPO-3

Species Name:
Mouse

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
Q9QUM4-1

Gene Id:
Thr25-Pro242TGGGVMDCPVILQKLGQDTWLPLTNEHQINKSVNKSVRILVTMATSPGSKSNKKIVSFDLSKGSYPDHLEDGYHFQSKNLSLKILGNRRESEGWYLVSVEENVSVQQFCKQLKLYEQVSPPEIKVLNKTQENENGTCSLLLACTVKKGDHVTYSWSDEAGTHLLSRANRSHLLHITLSNQHQDSIYNCTASNPVSSISRTFNLSSQACKQESSSESSPGGGSHHHHHHHH

Molecular Weight:
40-55kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
The type I transmembrane glycoprotein Signaling Lymphocytic Activation Molecule (SLAM), also known as CD150, is the prototypic member of the SLAM subgroup of the CD2 protein family. Alternate splicing generates an isoform with a substituted cytoplasmic domain. SLAM is expressed on T cells, B cells, thymocytes, macrophages, dendritic cells, platelets, and hematopoietic stem cells. It is up‑regulated on activated B cells and CD4+ and CD8+ T cells, although it is down‑regulated on Th2 polarized cells. SLAM interacts homophilically with low affinity, and this interaction induces a Th0/Th1 response characterized by clonal expansion, production of IFN-gamma, and increased cytolytic activity of CD8+ T cells. SLAM ligation also promotes B cell activation, allergen-induced eosinophil and mast cell activation, NKT cell development, and the microbicidal response of macrophages to Gram negative bacteria. In humans, SLAM functions as a cellular entry receptor for measles virus.

Reference:
1.Castro, A.G. et al. (1999) J. Immunol. 163:5860.2.Cocks, B.G. et al. (1995) Nature 376:260.3.Wang, N. et al. (2004) J. Exp. Med. 199:1255.4.Hahm, B. et al. (2004) Virology 323:292.5.Nanda, N. et al. (2005) Blood 106:3028.6.Kiel, M.J. et al. (2005) Cell 121:1109.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Neurotrophin-4 Protein
METRNL/Meteorin-like Protein
Popular categories:
Brutons Tyrosine Kinase (BTK)
Myelin Associated Glycoprotein (MAG/Siglec-4a)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer