Share this post on:

Name:
NRG1/Heregulin-β1 Protein

Synonyms:
Pro-neuregulin-1;Neuregulin-1 beta 1;NRG1-beta 1;HRG1-beta 1; EGF;NRG1; GGF; HGL; HRGA; NDF; SMDF

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q02297-6

Gene Id:
Ser177-Glu241SHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQNYVMASFYKHLGIEFMEAE

Molecular Weight:
7-8kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS,pH7.4.

Quality Statement:
Heregulin-β also known as neuregulin-1 (NRG-1) is a member of the epidermal growth factor (EGF) family of growth factors and acts as a ligand for ErbB family receptor tyrosine kinases. And NRG1 isoforms can signal in a paracrine, autocrine, or juxtacrine manner, playing a fundamental role during the development of the peripheral nervous system and during the process of nerve repair, suggesting that the treatment with NRG1 could improve functional outcome following injury. The NRG1 receptors are membrane-spanning receptor tyrosin kinases of the ErbB family (ErbB1–4), of which the EGF receptor (ErbB1) is the most prominent representative.

Reference:
Cell Rep. 2021 Sep 7;36(10):109656. doi: 10.1016/j.celrep.2021.109656. Cell Rep. 2021 Aug 17;36(7):109538. doi: 10.1016/j.celrep.2021.109538.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IgG4 Fc Protein
Cynomolgus IL-23 alpha & Mouse IL-12 beta Heterodimer Protein (HEK293
Popular categories:
URM1
Constitutive Androstane Receptor

Share this post on:

Author: Adenosylmethionine- apoptosisinducer