Share this post on:

Name:
NKG2D/CD314 Protein

Synonyms:
NKG2D,CD314,KLRK1,NK cell receptor D

Species Name:
Cynomolgus

Label Name:
Human Fc Tag

Marker Name:
Unconjugated

Accession:
P61252

Gene Id:
Phe78-Val216 MDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKIEGRFLNSLFNQEVQIPLTESYCGPCPKNWICYKNNCYQFFNESKNWYESQASCMSQNASLLKVYSKEDQDLLKLVKSYHWMGLVHIPTNGSWQWEDGSILSPNLLTIIEMQKGDCALYASSFKGYIENCSIPNTYICMQRTV

Molecular Weight:
55-70kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
NKG2D is a type II transmembrane glycoprotein having an extracellular lectin-like domain. This domain lacks the recognizable calcium-binding sites found in true C-type lectins and binds protein rather than carbohydrate ligands. Human ligands for NKG2D include MICA, MICB, and ULBP1,2, and 3. Expression of NKG2D ligands occurs in epithelial cells, tumor cells and under conditions of stress or infection. NKG2D exists as a disulfide-linked homodimer that delivers an activating signal upon ligand binding. NKG2D has been implicated in anti-tumor surveillance and the immune response against viral infection. In NK cells, NKG2D serves as an activating receptor, which itself is able to trigger cytotoxicity.

Reference:
1.Cerwenka, A. et al. (2001) Proc. Natl. Acad. Sci. USA 98:11521.2.Diefenbach, A. et al. (2001) Nature 413:165.3.NKG2D and its Ligands (2002) www.rndsystems.com.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
WARS Protein
PD-1 Protein
Popular categories:
Growth Differentiation Factor 3 (GDF-3)
Frizzled-1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer