Share this post on:

Name:
IL-19 Protein

Synonyms:
MDA1, NG.1,ZMDA1,IL-10C

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
Q9UHD0

Gene Id:
Leu25-Ala177(Phe175Ser)MLRRCLISTDMHHIEESFQEIKRAIQAKDTFPNVTILSTLETLQIIKPLDVCCVTKNLLAFYVDRVFKDHQEPNPKILRKISSIANSFLYMQKTLRQCQEQRQCHCRQEATNATRVIHDNY DQLEVHAAAIKSLGELDVFLAWINKNHEVMSSA

Molecular Weight:
18kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
100mM Hac,pH2.8.

Quality Statement:
IL-19 is member of the so-called IL-10 family of cytokines. This family also contains IL-10, an anti-inflammatory cytokine known of for a very long time, and six other mediators: IL-20, IL-22, IL-24, IL-26, IL-28A, IL-28B and IL-29. The members of the IL-10 family have the following features: clustering of their encoding genes, similar genomic structures, similar primary and secondary protein structures and use of similar receptor complexes. In fact, these nine proteins are encoded by genes that are found in the human genome in three clusters and have similar exon–intron structures. Interleukin- (IL-) 19, part of the IL-10 family, contributes to a range of diseases and disorders, such as asthma, endotoxic shock, uremia, psoriasis, and rheumatoid arthritis. IL-19 is expressed in several types of tumor cells, especially in squamous cell carcinoma of the skin, tongue, esophagus, and lung and invasive duct carcinoma of the breast.

Reference:
1.Robert Sabat, Elizabeth Wallace, StefanieEndesfelder, Kerstin Wolk. IL-19 and IL-20: two novel cytokines with importancein inflammatory diseases. Expert Opin Ther Targets. 2007 11(5):601-12. 2.Ying-YinChen, Chien-Feng Li, Ching-Hua Yeh, Ming-Shi Chang, Chung-Hsi HsingInterleukin-19 in breast cancer. Clin Dev Immumol.2013;294320. doi:10.1155/2013/294320.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
UBA1 Protein
Clusterin/APOJ Protein
Popular categories:
Polo-like Kinase (PLK)
CD281/TLR1

Share this post on:

Author: Adenosylmethionine- apoptosisinducer