Share this post on:

Name:
Biotinylated SLAMF7/CRACC/CD319 Protein

Synonyms:
CS1,UNQ576/PRO1138,Novel Ly9,SLAM Family Member 7,Membrane Protein FOAP-12,CD2 Subset 1,Protein 19A,CD2-Like Receptor Activating Cytotoxic Cells,CD2-Like Receptor-Activating Cytotoxic Cells,19A24 Protein,19A,CD319 Antigen,Novel LY9 (Lymphocyte Antigen 9) Like Protein

Species Name:
Human

Label Name:
Avi Tag, His Tag

Marker Name:
Biotin

Accession:
Q9NQ25

Gene Id:
Ser23-Met226SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMGGGSGLNDIFEAQKIEWHEHHHHHHHH

Molecular Weight:
35-45kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
SLAM family member 7 (SLAMF7) is also known as CD2-like receptor-activating cytotoxic cells (CRACC), Membrane protein FOAP-12, CD antigen CD319, Novel Ly9, Protein 19A, which is a single-pass type I membrane protein and a member of the CD2 family of cell surface receptors. Mature mouse CRACC consists of a 202 amino acid (aa) extracellular domain (ECD) with one Ig-like V-set domain and one Ig-like C2-set domain, a 21 aa transmembrane segment, and an 88 aa cytoplasmic domain with two immunoreceptor tyrosine-based switch motifs ITSMs. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Mediates natural killer (NK) cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway. Positively regulates NK cell functions by a mechanism dependent on the adapter SH2D1B. In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function.

Reference:
1. Veillette, A. (2006) Immunol. Rev. 214:22.2.Tovar, V. et al. (2002) Immunogenetics 54:394.3.Murphy, J.J. et al. (2002) Biochem. J. 361:431.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GRIK2 Protein
T-PA Protein
Popular categories:
FGF-12
Endothelin Receptor

Share this post on:

Author: Adenosylmethionine- apoptosisinducer