Share this post on:

Name:
Biotinylated Fc γ RIIB/CD32b Protein

Synonyms:
FCGR2B/C, CD32b/c, Fc RII-b/c, Fc-gamma RII-b/c, CD32, FCG2, IGFR2, CDw32

Species Name:
Cynomolgus

Label Name:
Avi Tag, His Tag

Marker Name:
Biotin

Accession:
Q8SPW3

Gene Id:
Ala46-Pro224APPKAVLKLEPPWINVLREDSVTLTCGGAHSPDSDSTQWFHNGNLIPTHTQPSYRFKANNNDSGEYRCQTGRTSLSDPVHLTVLSEWLALQTPHLEFREGETILLRCHSWKDKPLIKVTFFQNGISKKFSHMNPNFSIPQANHSHSGDYHCTGNIGYTPYSSKPVTITVQVPSMGSSSPGGGSGGGSHHHHHHHHHHGLNDIFEAQKIEWHE

Molecular Weight:
30-35kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
IgG Fc region receptors are members of the Ig superfamily that play roles in activating or inhibiting immune responses such as degranulation, phagocytosis, ADCC, cytokine release, and B-cell proliferation.There are three genes for human Fc γ RII /CD32 (A, B, and C) and one for mouse Fc γ RII B (CD32B). CD32 is a low affinity receptor for IgG. CD32B is expressed on B cells and myeloid dendritic cells. Ligation of CD32B on B cells downregulates antibody production and may, in some circumstances, promote apoptosis.

Reference:
1. Christopher T. Rankin, Maria-Concetta Veri, Sergey Gorlatov, Nadine Tuaillon, Steve Burke, Ling Huang, H. David Inzunza, Hua Li, Shannon Thomas, Syd Johnson, Jeffrey Stavenhagen, Scott Koenig, Ezio Bonvini: CD32B, the human inhibitory Fc-γ receptor IIB, as a target for monoclonal antibody therapy of B-cell lymphoma, Blood (2006) 108 (7): 2384–2391.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SCF Protein
TGFBR2/TGF-beta RII Protein
Popular categories:
CLEC14A
TIMP-2

Share this post on:

Author: Adenosylmethionine- apoptosisinducer