Share this post on:

Name:
Biotinylated Fc γ RIIA/CD32a Protein

Synonyms:
CD32a, FCGR2A, CD32, FCG2, FCGR2A1, IGFR2

Species Name:
Human

Label Name:
Avi Tag, His Tag

Marker Name:
Biotin

Accession:
P12318-1

Gene Id:
Ala36-Ile218 AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGIGGGSHHHHHHHHHHGLNDIFEAQKIEWHE

Molecular Weight:
30-35kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Receptors for the Fc region of IgG (Fc γ R) are members of the Ig superfamily that function in the activation or inhibition of immune responses. Human Fc gamma Rs are classified into three classes: RI (CD64), RII (CD32), and RIII (CD16), which give rise to multiple isoforms (1-3). Fc gamma RI is a high-affinity receptor that binds monomeric IgG, and Fc gamma RII and RIII are low-affinity receptors that bind aggregated or immune complex IgG (IC). The extracellular domain of human Fc gamma RIIA shares approximately 90% amino acid sequence identity with human Fc gamma RIIB and Fc gamma RIIC. Fc gamma RIIA is expressed on many immune cell types: macrophages, neutrophils, eosinophils, platelets, dendritic cells, and Langerhans cells, where inhibitory ITIM receptors may also be co-expressed and co-engaged by specific ligands. Signaling through FcγRIIA leads to the initiation of inflammatory responses (cytolysis, phagocytosis, degranulation, and cytokine production) that can be modulated by signals from inhibitory receptors. The strength of the signal depends on the ratio of activated and inhibitory receptor expression.

Reference:
1.Benjamin Descours, Gaël Petitjean, José-Luis López-Zaragoza, Timothée Bruel, Raoul Raffel, Christina Psomas, Jacques Reynes, Christine Lacabaratz, Yves Levy, Olivier Schwartz, Jean Daniel Lelievre & Monsef Benkirane: CD32a is a marker of a CD4 T-cell HIV reservoir harbouring replication-competent proviruses, Nature volume 543, pages564–567 (2017)..

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
IL-36 alpha/IL-1F6 Protein
UBE2G1 Protein
Popular categories:
CD134/OX40
IgG3

Share this post on:

Author: Adenosylmethionine- apoptosisinducer