Share this post on:

Name:
TMEM119 Protein

Synonyms:
TMEM119,OBIF

Species Name:
Human

Label Name:
Human Fc Tag

Marker Name:
Unconjugated

Accession:
Q4V9L6

Gene Id:
Arg26-Met96RSVPLKATFLEDVAGSGEAEGSSASSPSLPPPWTPALSPTSMGPQPITLGGPSPPTNFLDGIVDFFRQYVMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Weight:
37-50kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
TMEM119 (Transmembrane Protein 119, also known as Osteoblast Induction Factor or OBIF), is an approximately 38-kDa type 1 transmembrane protein. Mature human TMEM119 consists of a 71 amino acid (aa) extracellular domain (ECD), a 21 aa transmembrane segment, and a 166 aa cytoplasmic domain. It is predominantly expressed in osteoblasts and is upregulated during osteoblastic differentiation. TMEM-119 is involved in the osteoblast differentiation and bone development by acting as a ligand and has been reported to contribute to the proliferation, migration, and invasion of osteosarcoma cells, as well as functioning as an oncogene in osteosarcoma.

Reference:
1.Jiang, Z,H. et al. (2017) Expt & Mol Med. 49:e329.2.Satoh, J. et al. (2016) Neuropathol. 36:39.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
LAIR1 Protein
Carboxypeptidase E/CPE Protein
Popular categories:
Leukocyte Tyrosine Kinase
Gastrin

Share this post on:

Author: Adenosylmethionine- apoptosisinducer