Share this post on:

Name:
S100A8 Protein

Synonyms:
Calgranulin-A; Cystic fibrosis antigen; Leukocyte L1 complex light chain; MRP-8

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P05109

Gene Id:
Met1-Glu93MLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE

Molecular Weight:
12kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
pH7.5,20mMTris,300mM NaCl

Quality Statement:
S100A8 protein became the focus of intensive current research due to their association with numerous human disorders, including acute and chronic inflammatory conditions, autoimmune diseases, cancer, atherosclerosis, cardiomyopathies and neurodegenerative diseases, as well as due to their crucial roles in normal physiological processes within cells. S100A8 belongs to the family of low molecular weight S100 proteins (10–13 kDa) comprising 22 members to date and representing the largest subfamily of the EF-hand Ca2+-binding proteins. All S100 proteins share conserved structural motifs of two EF-hand Ca2+-binding domains connected by a variable hinge region that often confer biological activity. The tendency to form homodimers is common to all S100 proteins, including S100A8 and S100A9, with one exception—calbindin D9k is monomeric. Some members of the S100 protein family are also able to form heterodimers as observed f.e. for S100A8 and S100A9 or S100A1 and S100P, which suggests different functions for homo- and heterodimers.

Reference:
1.\t. and Anna L Gharibyan (2012) Int J Mol Sci. 13(3):2893-2917

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
OBP2B Protein
LAIR1 Protein
Popular categories:
TNF-β
ER-beta

Share this post on:

Author: Adenosylmethionine- apoptosisinducer