Leptin Protein | Adenosylmethionine

Name:
Leptin Protein

Synonyms:
Leptin, rRtLeptin, Obesity protein (OB), LEP

Species Name:
Mouse

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:

Gene Id:
Val22-Cys167 MVPIQKVQDDTKTLIKTIVTRINDISHTQSVSAKQRVTGLDFIPGLHPILSLSKMDQTLAVYQQVLTSLPSQNVLQIANDLENLRDLLHLLAFSKSCSLPQTSGLQKPESLDGVLEASLYSTEVVALSRLQGSLQDILQQLDVSPEC

Molecular Weight:
16kDa (Reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 50mM NaCl，pH 8.0

Quality Statement:
Leptin is the protein product encoded by the obese (ob) gene. It is a circulating hormone produced primarily by the adipose tissue, Which is an adipocyte-derived hormone that acts as a major regulator for food intake and energy homeostasis. Leptin deficiency or resistance can result in profound obesity, diabetes, and infertility in humans. Leptin serves as an adiposity signal to inform the brain the adipose tissue mass in a negative feedback loop regulating food intake and energy expenditure. It also plays important roles in angiogenesis, immune function, fertility, and bone formation.

Reference:
1.\tVitam Horm. 2005;71:345-72. doi: 10.1016/S0083-6729(05)71012-8. 2.\tCell Res. 2000 Jun;10(2):81-92. doi: 10.1038/sj.cr.7290038.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
SARS-CoV-2 NSP8 Protein (His)
METRNL/Meteorin-like Protein
Popular categories:
SARS-CoV-2 NSP10
CXCR7

Author: Adenosylmethionine- apoptosisinducer

Related Posts