Share this post on:

Name:
ERMAP Protein

Synonyms:
hERMAP; MGC118810; MGC118811; PRO2801; RDMGC118812; SC; SCMGC118813

Species Name:
Human

Label Name:
Human Fc Tag

Marker Name:
Unconjugated

Accession:
Q96PL5

Gene Id:
His30-Ala155HAGDAGKFHVALLGGTAELLCPLSLWPGTVPKEVRWLRSPFPQRSQAVHIFRDGKDQDEDLMPEYKGRTVLVRDAQEGSVTLQILDVRLEDQGSYRCLIQVGNLSKEDTVILQVAAPSVGSLSPSAIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Weight:
45-55kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Erythroid membrane-associated protein (ERMAP), also called Scianna blood group antigen, is a member of the butrophilin (BTN) and butrophilin-like (BTNL) family within the immunoglobulin superfamily. ERMAP is an adhesion receptor molecule highly expressed in erythroid tissues, on the cell surface of resting and activated antigen-presenting cells (APCs) and in some tumor tissues. Fusion proteins (ERMAP-Ig) of both human and mouse ERMAP inhibit T cell functions in vitro and administration of the fusion protein ameliorates autoimmune diseases, including experimental autoimmune encephalomyelitis and type 1 diabetes, in mice. ERMAP acts as a novel inhibitory molecule for T cells and macrophages.

Reference:
1.Xu, H. et al. (2001) Genomics 76:2.2.Abeler-Dorner, L. et al. (2012) Trends Immunol. 33:34.3.Su, M. et al. (2020) Cell. Mol. Immunol. doi: 10.1038/s41423-020-0494-8.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Animal-Free Pleiotrophin Protein
BAFF/TNFSF13B Protein
Popular categories:
CD136
Ubiquitin-Specific Protease 9

Share this post on:

Author: Adenosylmethionine- apoptosisinducer