TMEM149/IGFLR1 Protein | Adenosylmethionine

Name:
TMEM149/IGFLR1 Protein

Synonyms:
U2AF1L4

Species Name:
Human

Label Name:
null

Marker Name:
Unconjugated

Accession:
Q9H665

Gene Id:
Ser23-Pro163SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLPIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Molecular Weight:
43-55kDa (Reducing)

Purity:
＞95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Insulin Growth Factor-Like receptor 1 (IGFLR1), also known as transmembrane protein 149 (TMEM149), is a protein encoding gene located on chromosome 19 and is widely expressed in lymph nodes, spleen and kidney. Although studies have shown that high expression level of IGFLR1 could predict poor survival among patients with ccRCC (Clear cell renal cell carcinoma), the mechanism of the cancer-promoting effect of IGFLR1 has been still unclear and previous studies were limited to carbohydrate metabolism. Adrian et al. found that IGFLR1 was similar in structure to the tumor necrosis factor receptor family (TNFRs) and considered to be a novel receptor in the TNFRs. IGFLR1 may be a tumor immune-related molecule. However, the potential function and prognostic value of IGFLR1 in tumor progression and tumor immunology remained unclear.

Reference:
Wenjing Song, Xin He, Pengju Gong, Yan Yang, Sirui Huang, Yifan Zeng, Jingwei Zhang. IGFLR1 as a Novel Prognostic Biomarker in Clear Cell Renal Cell Cancer Correlating With Immune Infiltrates. Front Mol Biosci. 2020 Nov 26;7:565173. doi: 10.3389/fmolb.2020.565173. eCollection 2020.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Activin RIB/ALK-4 Protein
SCG3/Secretogranin-3 Protein
Popular categories:
Caspase-4
IL-20

Author: Adenosylmethionine- apoptosisinducer

Related Posts