Share this post on:

Name:
IL-1β Protein

Synonyms:
IL-1β, IL-1b, IL-1beta

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P01584

Gene Id:
Ala117-Ser269APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS

Molecular Weight:
18kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 100mM NaCl, pH8.0

Quality Statement:
Interleukin-1 beta (IL1 beta or IL1B) also known as catabolin, is a member of the interleukin 1 cytokine family. The interleukin-1 system (IL-1) is a prominent pro-inflammatory pathway responsible for the initiation and regulation of immune responses, but it has also received much attention for its pleiotropic neuromodulator effects under physiological and pathophysiological conditions. In particular, its main cytokine ligand, IL-1β, has emerged as a key regulator of the ethanol-induced neuroimmune response, contributing to ethanol drinking and the development of ethanol dependence. Human genetic studies have found polymorphisms in genes encoding components of the IL-1β signaling pathway and IL-1β associated with increased susceptibility to alcoholism, and IL-1β levels are elevated in the periphery and brain of alcoholic patients. Therefore, elucidating the mechanistic role of IL-1β in ethanol drinking and dependence is critical for understanding disease progression, as well as for the identification of novel therapeutic targets.

Reference:
Reesha R P. (2019) IL-1β expression is increased and regulates GABA transmission following chronic ethanol in mouse central amygdala. Brain Behav Immun. 75: 208-219.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
NKG2D/CD314 Protein
Neuroligin-3/NLGN3 Protein
Popular categories:
ILT-4
Activated Leukocyte Cell Adhesion Molecule (ALCAM)

Share this post on:

Author: Adenosylmethionine- apoptosisinducer