Share this post on:

Name:
DLL3 Protein

Synonyms:
Delta3, delta-like 3 (Drosophila), delta-like protein 3, Pudgy, SCDO1, SCDO1delta3

Species Name:
Cynomolgus

Label Name:
His Tag

Marker Name:
Unconjugated

Accession:
A0A2K5WSR1

Gene Id:
Ala27-Arg490AGVFELQIHSFGPGPGPGAPRSPCSARGPCRLFFRVCLKPGLSEEAAESPCALGAALSARGPVYTEQPEAPAPDLPLPNGLLQVPFRDAWPGTFSLIIETWREELGDQIGGPAWSLLARVTRRRRLAAGGPWARDIQRAGAWELRFSYRARCELPAVGTACTRLCRPRSAPSRCGPGLRPCAPLEDECEAPPVCRAGCSLEHGFCEQPGECRCLEGWTGPLCMVPVSTSSCLGLRGPSSTTTGCLVPGPGPCDGNPCANGGSCSETPGSFECTCPRGFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYICHCPPGFQGSNCEKRVDRCSLQPCRNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCAGRACANGGTCVEGGGAHRCSCALGFGGRNCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPDGVSALPAAPPGLRPGDPQRGGGSHHHHHHHH

Molecular Weight:
55kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Delta-like protein 3 (DLL3) is a transmembrane protein that belongs to the Delta/Serrate/Lag-2 (DSL) family of Notch ligands. DLL3 is known as a divergent DSL ligand since it does not function in similar manner as the rest of DSL ligands. It does not activate Notch signaling through trans-activation, but autonomously attenuates signaling induced by other DSL ligands. A loss-of-function mutation of DLL3 is linked to axial skeletal defects in the spondylocostal dysplasia, which is linked to abnormal Notch signaling. DL-3 promotes proliferation and inhibits apoptosis of cancer cells. The proliferative effect mediated by DLL3 is thought to be due to increased Akt phosphorylation in cancer cells. The Notch pathway is a highly conserved cell signaling pathway that is implicated in malignant transformation, cell proliferation, cycle arrest, and apoptosis, epithelial to mesenchymal transition, and suppression of neuroendocrine differentiation. The Notch signaling pathway is initiated by the binding of one of five ligands (Jagged 1, Jag 2, DLL1, DLL3, DLL4) with one of four receptors (Notch 1-4). The DLL family of proteins interact with EGF repeats on Notch receptors on cell membranes, triggering Notch signaling. In canonical Notch signaling, ligand binding results in the intracellular cleavage of the receptor by metalloproteases, and the Notch intracellular domain then translocates into the nucleus and modulates transcription of Notch-responsive genes. Notch signaling can be oncogenic or tumor suppressive depending on the cellular context. DLL3 is a noncanonical inhibitory ligand of the Notch receptor that is involved in NEC/NET tumorigenesis. DLL3 is thought to inhibit Notch signaling in cis; it does not bind or activate Notch receptors when presented in trans. In normal tissues, DLL3 is generally expressed at low levels (if at all) and confined to the cytoplasm. It regulates Notch signaling by preventing the localization of Notch receptors to the cell surface and redirecting them to the endosomes for degradation.

Reference:
1.Ladi E. et al. (2005) The divergent DSL ligand DLL3 does not activate Notch signaling but cell autonomously attenuates signaling induced by other DSL ligands. J Cell Biol. 170: 983-992.2.Xiu M X. et al. (2020) The role of DLLs in cancer: a novel therapeutic target. Onco Targets Ther. 13: 3881-3901.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
Noggin Protein
LAIR2 Protein
Popular categories:
CD282/TLR2
MCP-2 Protein/CCL8

Share this post on:

Author: Adenosylmethionine- apoptosisinducer