Share this post on:

Name:
LIF Protein

Synonyms:

Species Name:
Human

Label Name:
No Tag

Marker Name:
Unconjugated

Accession:
P15018

Gene Id:
Ser23-Phe202SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF

Molecular Weight:
19-20kDa (Non-reducing)

Purity:
>95%by SDS-PAGE&RP-HPLC

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.5-1mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
· 12 months from date of receipt, -20 to -70 °C as supplied. · 6 months, -20 to -70 °C under sterile conditions after reconstitution.· 1 week, 2 to 8 °C under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles.

Buffer System:
20mM Tris, 200mM NaCl, pH8.0

Quality Statement:
Leukaemia inhibitory factor (LIF) is produced by many different cell types and has pleiotropic actions. LIF stimulates the differentiation of the macrophage cell line M1, and the proliferation of haematopoietic stem cells. In vivo, it has profound effects on haematopoiesis, particularly in combination with other cytokines such as IL-3, causing increased platelet formation. LIF allows embryonic stem cells to remain in an undifferentiated state and can maintain their proliferation in culture. LIF stimulates synthesis of acute phase proteins by liver cells, increases bone resorption, stimulates differentiation of cholinergic nerves and loss of body fat.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
CD40L/CD154/TRAP Trimer Protein
HER2/CD340 Protein
Popular categories:
IL-7
PTPN22

Share this post on:

Author: Adenosylmethionine- apoptosisinducer