Share this post on:

Name:
Biotinylated EMMPRIN/CD147 Protein

Synonyms:
BSG, Extracellular matrix metalloproteinase inducer, Basigin (Ok Blood Group),Tumor Cell-Derived Collagenase Stimulatory Factor, Leukocyte Activation Antigen M6, Collagenase Stimulatory Factor, CD147 Antigen, EMPRIN, TCSF, EMMPRIN, SLC7A11

Species Name:
Human

Label Name:
Avi Tag, His Tag

Marker Name:
Biotin

Accession:
Q54A51

Gene Id:
Ala22-His205AAGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSHGGGSGLNDIFEAQKIEWHEHHHHHH

Molecular Weight:
25-35kDa (Reducing)

Purity:
>95% by SDS-PAGE

Physical Appearance Name:
Lyophilized Powder

Endotoxin Name:
<0.1EU/μg

Reconstitution:
Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability Storage:
·12 months from date of receipt, -20 to -70 °C as supplied. ·1 month, 2 to 8 °C under sterile conditions after reconstitution. ·Please avoid repeated freeze-thaw cycles.

Buffer System:
PBS, pH7.4.

Quality Statement:
Extracellular matrix metalloproteinase (MMP) inducer (EMMPRIN), also known as basigin and CD147, is a 44-66 kDa, variably N- and O-glycosylated, type I transmembrane protein that belongs to the immunoglobulin superfamily. EMMPRIN belongs to the immunoglobulin (Ig) superfamily and is composed of two C2-like immunoglobulin extracellular domains, a transmembrane domain and a short cytoplasmic domain. The extracellular region, which contains three conserved N-glycosylation sites that are variably glycosylated, has been implicated in EMMPRIN self association, while the first Ig domain within this region is required for counter-receptor activity involved in MMP induction. The highly conserved transmembrane domain and the short cytoplasmic domain are thought to be implicated in interactions between EMMPRIN and other molecular partners within the membrane. In particular, EMMPRIN was shown to interact with integrins α3β1 and α6β1, enhancing the adhesion and spreading of the cell to the ECM and to caveolin-1 in lipid rafts leading to a decrease in EMMPRIN cell surface self association.

Reference:
1. Gabison, E. E. et al. (2005) Biochimie 87:361.2. Yurchenko, V. et al. (2006) Immunology 117:301.3. Kasinrerk, W. et al. (1992) J. Immunol. 149:847.4. Iacono, K.T. et al. (2007) Exp. Mol. Pathol. 83:283.5. Muramatsu T, Miyauchi T. Basigin (CD147): a multifunctional transmembrane protein involved in reproduction, neural function, inflammation and tumor invasion. Histol Histopathol. 2003;18:981–7.

MedChemExpress (MCE) recombinant proteins include: cytokines, enzymes, growth factors, hormones, receptors, transcription factors, antibody fragments, etc. They are often essential for supporting cell growth, stimulating cell signaling pathways, triggering or inhibiting cell differentiation; and are useful tools for elucidating protein structure and function, understanding disease onset and progression, and validating pharmaceutical targets. At MedChemExpress (MCE), we strive to provide products with only the highest quality. Protein identity, purity and biological activity are assured by our robust quality control and assurance procedures.
Related category websites: https://www.medchemexpress.com/recombinant-proteins.html
Popular product recommendations:
GMP Fibronectin Protein
OGG1 Protein
Popular categories:
Cyclin-Dependent Kinase Inhibitor Proteins
BAFF R/CD268

Share this post on:

Author: Adenosylmethionine- apoptosisinducer